KEGG   Caenorhabditis elegans (nematode): CELE_T14F9.3Help
Entry
CELE_T14F9.3      CDS       T00019                                 

Gene name
hex-1
Definition
Protein HEX-1
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CELE_T14F9.3 (hex-1)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    CELE_T14F9.3 (hex-1)
   00603 Glycosphingolipid biosynthesis - globo series
    CELE_T14F9.3 (hex-1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    CELE_T14F9.3 (hex-1)
   00511 Other glycan degradation
    CELE_T14F9.3 (hex-1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    CELE_T14F9.3 (hex-1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CELE_T14F9.3 (hex-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(2223487..2223585,2223630..2223756,2223810..2223935,2223981..2224096,2224438..2224650,2224694..2224924,2224969..2225144,2225192..2225452,2225494..2225616,2226317..2226512)
Genome map
AA seq 555 aa AA seqDB search
MRLLIPILIFALITTAVTWFYGRDDPDRWSVGGVWPLPKKIVYGSKNRTITYDKIGIDLG
DKKDCDILLSMADNYMNKWLFPFPVEMKTGGTEDFIITVTVKDECPSGPPVHGASEEYLL
RVSLTEAVINAQTVWGALRAMESLSHLVFYDHKSQEYQIRTVEIFDKPRFPVRGIMIDSS
RHFLSVNVIKRQLEIMSMNKLNVLHWHLVDSESFPYTSVKFPELHGVGAYSPRHVYSRED
IADVIAFARLRGIRVIPEFDLPGHTSSWRGRKGFLTECFDEKGVETFLPNLVDPMNEANF
DFISEFLEEVTETFPDQFLHLGGDEVSDYIVECWERNKKIRKFMEEKGFGNDTVLLENYF
FEKLYKIVENLKLKRKPIFWQEVFDNNIPDPNAVIHIWKGNTHEEIYEQVKNITSQNFPV
IVSACWYLNYIKYGADWRDEIRGTAPSNSRYYYCDPTNFNGTVAQKELVWGGIAAIWGEL
VDNTNIEARLWPRASAAAERLWSPAEKTQRAEDAWPRMHELRCRLVSRGYRIQPNNNPDY
CPFEFDEPPATKTEL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttttaattcccatacttatattcgccctgattaccactgccgttacttggttc
tacggcagagacgacccggaccgttggagcgtaggaggggtctggccactcccgaaaaaa
attgtctatgggtctaagaatcgaacaatcacttatgataaaatcggaattgatcttggc
gacaaaaaagattgcgatattttactatccatggctgataattacatgaataagtggttg
ttcccattcccagttgaaatgaaaactggtgggactgaagattttattataactgtcact
gtaaaagacgagtgtcccagcggtccaccagtacacggagccagtgaagaatatctactt
cgagtcagtctaacagaagcggttatcaatgctcaaactgtgtggggagcattgagagca
atggaatcacttagtcatttggttttttatgatcataagtcacaagaatatcaaattcga
actgtggaaatctttgacaaaccacgtttccctgtacgtggaattatgatcgactcgagt
cgtcattttctttctgtgaacgttattaaaagacaattggaaatcatgtcaatgaataaa
ctaaatgtacttcattggcaccttgtagacagcgaatcattcccgtatacatctgtcaag
ttcccagagctacatggagttggagcctactctcctcgccacgtctactcccgtgaagat
attgccgacgttattgcctttgcaaggcttcggggaattcgtgttattcctgaattcgat
ttacccggacatacatcttcctggagaggcagaaagggattcttaacggaatgttttgac
gagaagggtgtagagacttttttgcccaatttggtagatcccatgaatgaagccaatttt
gattttatttccgaatttttggaagaggtcacagaaactttcccagatcagttcctgcat
cttggtggggatgaagtgtcggattatattgtagaatgctgggagagaaacaagaaaatt
cgaaagtttatggaggagaaaggatttggaaatgacactgtgcttctggaaaactatttc
ttcgaaaagttgtacaaaattgtagaaaatttgaagttaaagcgtaagccaatattttgg
caagaagtctttgataacaacattcctgatccaaacgcggtgatccatatttggaaagga
aacactcacgaggagatttacgagcaagtgaagaacatcacatctcaaaacttcccagtg
attgtgtccgcgtgctggtacttgaactatatcaaatatggcgctgactggagggatgag
attcgcggaactgcaccatcaaactcaagatactactattgtgatccaacaaacttcaat
ggaacggtggcgcagaaggaattggtttggggtggtattgctgcaatttggggagagtta
gtggacaacactaatattgaagctagactttggccaagagcttctgcagccgctgaaaga
ctttggtcgcccgccgaaaagacgcaacgggccgaagacgcatggcctcgaatgcacgaa
cttcgttgtcgattggtctcaaggggataccgtattcagccgaacaacaaccccgattat
tgtcccttcgagttcgatgaacctccagcaacgaagacagagctttaa

DBGET integrated database retrieval system