KEGG   Caenorhabditis elegans (nematode): CELE_T14F9.3Help
Entry
CELE_T14F9.3      CDS       T00019                                 

Gene name
hex-1
Definition
Protein HEX-1
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cel00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:cel00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:cel00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cel00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:cel04142]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(2223479..2223577,2223622..2223748,2223802..2223927,2223973..2224088,2224430..2224642,2224686..2224916,2224961..2225136,2225184..2225444,2225486..2225608,2226309..2226504)
Genome map
AA seq 555 aa AA seqDB search
MRLLIPILIFALITTAVTWFYGRDDPDRWSVGGVWPLPKKIVYGSKNRTITYDKIGIDLG
DKKDCDILLSMADNYMNKWLFPFPVEMKTGGTEDFIITVTVKDECPSGPPVHGASEEYLL
RVSLTEAVINAQTVWGALRAMESLSHLVFYDHKSQEYQIRTVEIFDKPRFPVRGIMIDSS
RHFLSVNVIKRQLEIMSMNKLNVLHWHLVDSESFPYTSVKFPELHGVGAYSPRHVYSRED
IADVIAFARLRGIRVIPEFDLPGHTSSWRGRKGFLTECFDEKGVETFLPNLVDPMNEANF
DFISEFLEEVTETFPDQFLHLGGDEVSDYIVECWERNKKIRKFMEEKGFGNDTVLLENYF
FEKLYKIVENLKLKRKPIFWQEVFDNNIPDPNAVIHIWKGNTHEEIYEQVKNITSQNFPV
IVSACWYLNYIKYGADWRDEIRGTAPSNSRYYYCDPTNFNGTVAQKELVWGGIAAIWGEL
VDNTNIEARLWPRASAAAERLWSPAEKTQRAEDAWPRMHELRCRLVSRGYRIQPNNNPDY
CPFEFDEPPATKTEL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttttaattcccatacttatattcgccctgattaccactgccgttacttggttc
tacggcagagacgacccggaccgttggagcgtaggaggggtctggccactcccgaaaaaa
attgtctatgggtctaagaatcgaacaatcacttatgataaaatcggaattgatcttggc
gacaaaaaagattgcgatattttactatccatggctgataattacatgaataagtggttg
ttcccattcccagttgaaatgaaaactggtgggactgaagattttattataactgtcact
gtaaaagacgagtgtcccagcggtccaccagtacacggagccagtgaagaatatctactt
cgagtcagtctaacagaagcggttatcaatgctcaaactgtgtggggagcattgagagca
atggaatcacttagtcatttggttttttatgatcataagtcacaagaatatcaaattcga
actgtggaaatctttgacaaaccacgtttccctgtacgtggaattatgatcgactcgagt
cgtcattttctttctgtgaacgttattaaaagacaattggaaatcatgtcaatgaataaa
ctaaatgtacttcattggcaccttgtagacagcgaatcattcccgtatacatctgtcaag
ttcccagagctacatggagttggagcctactctcctcgccacgtctactcccgtgaagat
attgccgacgttattgcctttgcaaggcttcggggaattcgtgttattcctgaattcgat
ttacccggacatacatcttcctggagaggcagaaagggattcttaacggaatgttttgac
gagaagggtgtagagacttttttgcccaatttggtagatcccatgaatgaagccaatttt
gattttatttccgaatttttggaagaggtcacagaaactttcccagatcagttcctgcat
cttggtggggatgaagtgtcggattatattgtagaatgctgggagagaaacaagaaaatt
cgaaagtttatggaggagaaaggatttggaaatgacactgtgcttctggaaaactatttc
ttcgaaaagttgtacaaaattgtagaaaatttgaagttaaagcgtaagccaatattttgg
caagaagtctttgataacaacattcctgatccaaacgcggtgatccatatttggaaagga
aacactcacgaggagatttacgagcaagtgaagaacatcacatctcaaaacttcccagtg
attgtgtccgcgtgctggtacttgaactatatcaaatatggcgctgactggagggatgag
attcgcggaactgcaccatcaaactcaagatactactattgtgatccaacaaacttcaat
ggaacggtggcgcagaaggaattggtttggggtggtattgctgcaatttggggagagtta
gtggacaacactaatattgaagctagactttggccaagagcttctgcagccgctgaaaga
ctttggtcgcccgccgaaaagacgcaacgggccgaagacgcatggcctcgaatgcacgaa
cttcgttgtcgattggtctcaaggggataccgtattcagccgaacaacaaccccgattat
tgtcccttcgagttcgatgaacctccagcaacgaagacagagctttaa

DBGET integrated database retrieval system