KEGG   Caenorhabditis elegans (nematode): CELE_T19B10.3Help
Entry
CELE_T19B10.3     CDS       T00019                                 

Gene name
T19B10.3
Definition
Protein T19B10.3
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CELE_T19B10.3 (T19B10.3)
  Lipid metabolism
   00600 Sphingolipid metabolism
    CELE_T19B10.3 (T19B10.3)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    CELE_T19B10.3 (T19B10.3)
   00604 Glycosphingolipid biosynthesis - ganglio series
    CELE_T19B10.3 (T19B10.3)
   00511 Other glycan degradation
    CELE_T19B10.3 (T19B10.3)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    CELE_T19B10.3 (T19B10.3)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CELE_T19B10.3 (T19B10.3)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_T19B10.3 (T19B10.3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(11222976..11223401,11223453..11223671,11223814..11223973,11224018..11224483,11224526..11224725,11224769..11224859,11224908..11224993,11225049..11225252,11225902..11226011))
Genome map
AA seq 653 aa AA seqDB search
MELWKSCIFLFLNFCIQSEGIVRTSYGNWNIPKIGDRNIPSFLIDESKNQFLLDGLPFRY
ISGSIHYFRIPRDRWDERLGKVRALGFNAIQYYIPWNMHELEEGNHDFSGLLDFAEFSMM
AFHKYGLWTILRVGPYICGELENGGLPWWLLNKNVTKQRSSDRVFTREVENWFEILLPRV
KPLLRKNGGPVLMLQIENEYGSYDACDQQYLRFLRDLTRSLVGDDVLLFTTDGSAESLLK
CGTVEGVFPTVDFGPTDDAKEIENNFKLQRKFAPNGPLVNSEYYPGWLVLWGQKKQNLPS
PQTIINGSQTMYSLGASFNYYMIHGGTNFGFWNGAETEAPCITSYDYDAPISESGDVTTK
YLEIRKWIKGLTDWPTPPLDVPGNSPKGRFGKIKMRLVHSVEKLKTLTSLGDPGDCVETD
KPISFETLKHPLGLVAYQAKINSCGNLTIPSFGDFVHVYLNGKYIDTLTRRYYNLTRNSV
IIEGCLENEENRLFMLVENQGRKTFETINDRKGILSDVFMNGQAIQFWTQCGIKLPLQED
FYFRKAMRNNYRKNVKSNQKQGVFIGILSVDAPTDTWLDTTGWGKGIAIVNGRNFGRYWP
TKGPQMTLYIPAEFLKIGENSVMMVELEGAEEACTSTSSCIADFIDHPVFDFQ
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggaattatggaaaagctgtatatttctgtttttaaatttttgcattcaatctgaaggt
atcgtcagaacaagttacggcaattggaatattccaaaaattggtgatagaaatatacct
tcatttcttattgacgaatcaaagaaccaatttctactcgatggtcttccatttcgttac
atctctggatccattcattatttccgaattcctcgtgatcggtgggacgaacgtctcggg
aaagttcgagctcttggatttaatgcaattcagtattatattccatggaatatgcacgag
cttgaagaaggaaatcatgacttttctggacttctcgatttcgcagagttttccatgatg
gcttttcataaatatggattatggacaattttgagagtcggaccgtatatttgtggagaa
ttggaaaatggagggcttccatggtggcttctcaacaaaaatgtgacaaagcaaagaagt
agtgatcgagtgtttacccgcgaagtcgagaattggtttgaaattcttcttccaagagtc
aagccacttttacgtaaaaacggtggacctgtcctgatgcttcaaattgaaaatgagtac
ggtagttacgatgcatgcgatcaacaatatcttcgattcttgcgagatcttacaagatca
ctcgttggggatgatgttctattattcacaactgatggttctgccgagtctctgctaaaa
tgtggaacagtggaaggagtatttccaactgtagactttggtccaactgatgatgctaaa
gaaatcgaaaacaattttaaattacaaagaaaatttgcaccgaatggccctctagtaaat
tcggaatattatcctggatggttggtactttggggacaaaagaagcaaaatttaccgtct
ccacaaacaataatcaatggatcacaaactatgtattctcttggtgccagtttcaattat
tatatgattcacggaggcaccaattttggattttggaatggtgcagaaactgaggctcct
tgcattacttcttacgattatgatgctccgattagtgaatctggagatgtaacaaccaaa
tatttggaaataagaaaatggatcaaaggattgactgattggccaactccaccattggat
gttccaggaaattcaccaaaaggaagatttggaaaaatcaagatgagactagtgcattcc
gttgaaaaattgaaaacactaacttcattgggagatcccggagattgtgttgaaactgat
aaaccaatcagttttgagacattgaagcatccattaggattggtagcttatcaggcaaaa
attaactcatgtggaaacttgacaattccctcatttggagattttgttcatgtttatctc
aatggaaagtacattgacactctcacgcgaagatattacaacctgaccagaaactcagtg
atcattgaaggttgcctggagaatgaagagaatcggctttttatgttggtcgaaaatcaa
ggaagaaaaacattcgaaacaattaatgatagaaagggaattctttcggatgtttttatg
aatggacaggcgattcaattttggactcaatgtggaatcaagcttcctcttcaagaagac
ttctacttcagaaaagcaatgagaaacaattaccggaagaatgttaaaagtaatcaaaaa
cagggagttttcattggaattcttagtgtggatgccccaactgatacatggcttgacact
actggatggggaaaaggaattgcaattgtgaatggaagaaattttggaagatattggcca
actaaaggtccacaaatgactttgtacattccagcagaattcttgaaaattggagaaaat
tcagtgatgatggttgagctagaaggagctgaggaagcttgtacaagtacatcatcgtgc
attgctgactttattgatcatcctgtttttgattttcaatga

DBGET integrated database retrieval system