KEGG   Caenorhabditis elegans (nematode): CELE_T20G5.1Help
Entry
CELE_T20G5.1      CDS       T00019                                 

Gene name
chc-1
Definition
Protein CHC-1
Orthology
K04646  
clathrin heavy chain
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Lysosome
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:cel04144]
Cellular Processes; Transport and catabolism; Lysosome [PATH:cel04142]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(10203781..10203903,10203951..10204071,10204123..10204487,10204534..10204713,10204822..10205682,10205727..10206029,10206077..10207231,10207278..10208499,10208552..10209130,10209179..10209315)
Genome map
AA seq 1681 aa AA seqDB search
MALPIKFHEHLQLPNAGIRVPNITFSNVTMESDKNIVVREMIGDQQQVVIIDLADTANPT
RRPISADSVIMHPTAKILALKSGKTLQIFNIELKAKVKAHQNVEDVVYWKWISEKTIALV
SDTAVYHWSIEGDAAPVKMFDRHQSLAGTQIINYRADAENKWLVLIGISAKDSRVVGSMQ
LYSTERKVSQPIEGHAACFVRFKVDGNQNPSNLFCFSVKTDNGGKLHVIEVGTPAAGNTP
FQKKNVDVPYTADTAGDFPVSMQVSAKQGIIYLVTKQGYVHLYDVESGTRIYSNRISTDT
VFVTCEYTATGGIMGINRKGQVLSVSIDEANLVPFVTNQLQNPDLALKLAVRCDLPGAEE
LFVRKFNLLFSNGQFGESAKVAASAPQGILRTPATIQKFQQCPSTGPGPSPLLQYFGILL
DQGKLNKYETLELCRPVLAQGRKELITKWLNDQKLECCEELGDLIKPHDVNTALSVYLRG
NVPHKVVQSFAETGQFDKIVMYAKRVGFQPDYLFQLRQILRNSNPDHGAKFAQLLVSESE
NGEPLADLSQIIDCFMEVQAVQPCTSFLLEVLKGDKPEEGHLQTRLLEMNLLAAPAVADA
ILANKMFSHYDRAAIGQLCEKAGLLQRALEHFTDLYDIKRTVVHTHLLKPDWLVGYFGSL
SVEDSVECLKAMLTQNIRQNLQVVVQIASKYHEQLGADKLIEMFENHKSYEGLFYFLGSI
VNFSQDPEVHFKYIQAATRTGQIKEVERICRESQCYDAERVKNFLKEAKLNDQLPLIIVC
DRHNMVHDLVLYLYRNQLQKYIEVFVQKVNAARLPIVVGALLDVDCSEDAIKQLIINTRG
KFDIDELVEEVEKRNRLKLLNHWLESKIQEGATDAATHNAMAKIYIDSNNNPERFLKENP
YYDSKVVGKYCEKRDPHYAFLSYERGQCDAELINVCNENSLFKNLARYLVKRRDFTLWEQ
VLNEENVHRRQLIDQVVQTALSETQDPEDISVTVKAFMAADLPNELIELLEKIVLDNSAF
SEHRNLQNLLILTAMRADRTRVMEYIQKLDNYDAPDIANIAITSELYEEAFAIFKKFDVN
SSAINVLIENVNNLDRAYEFAEKCNQSDVWASLAKAQLQQNLVKEAVDSFIKADDPGAYM
EVVNKCSQTEHWEDLVRYLQMARKKSRESYIETELVFALAKTGRLTELEEFIAGPNHAQI
GQIGDRCFDNGMFDSAKILFNNVSNFAKLSVTLVRLGEYQGAVDAARKANSTKTWKQVCF
SCVENGEFRLAQMCGLHIVVHADELEELINFYQDRGHFEELIALLEAALGLERAHMGMFT
ELAILYSKYKPEKMREHLELFWSRVNIPKVLRAAEQAHLWSELVFLYDKYEEYDNAALTM
MQHPTESWREQHFKEVIAKVANVELYYKAMQFYLDYKPLLLNDLLTVLSPRLDHSRTVLF
FNKLKQIPLVKPYLRQVQNLNNKAINEALNQLLIDEEDHAGLRSSIEAQDNFDNITLAQQ
LEKHPLVEFRRISAYLFKGNNRWKQSIELCKKDKLYKDAMEYAAESRNGELAEELLSFFL
DEKLYDCFAASLYHCYDLLHPDVIMELAWKHKIMDYAMPYMIQVMRDYQTRLEKLERSEH
ERKEEKAEQQQNNGMTMEPQLMLTYGAPAPQMTYPGTTGGYGGQPAYGQPGQPGYNAPGF
M
NT seq 5046 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcccaatcaaatttcacgagcacctgcagcttccgaatgctggaattcgggtg
cccaacattacattctccaatgtcacaatggaatctgataagaacattgttgttcgtgag
atgattggtgatcaacaacaggttgtgattattgatttggccgacacagcgaatccaact
cgtcgtccaatttctgctgactcagtaatcatgcacccaactgccaaaattcttgctttg
aaatctggcaagacacttcaaattttcaatattgagttgaaagcaaaagtgaaagctcat
cagaatgtagaagatgtagtttattggaagtggatcagtgagaaaacgattgcactcgtt
tccgacacagccgtctatcattggtcgatcgagggtgatgcagctccagtcaagatgttc
gatagacatcagtcgttggccggaactcaaatcataaattatcgcgctgatgccgaaaac
aagtggctcgttcttattggaatttccgcaaaagactcccgtgtcgttggaagtatgcaa
ttgtacagtaccgagagaaaagtatcgcagccaatcgaaggccatgccgcttgcttcgtt
cgattcaaggtcgatggaaaccaaaacccatctaacttattctgtttttccgtcaaaacc
gataatggaggaaaattgcacgttattgaagtaggaaccccagctgctggaaacactcct
ttccaaaagaagaatgttgatgttccatataccgctgacacagctggcgattttccagtg
tctatgcaggtatctgcgaagcaaggaattatttacctggtaacaaagcaaggatatgtt
catctttatgatgtcgagtctggaacacggatttattcgaatcgaatttcgactgatacc
gtatttgtgacctgtgaatacacagctacaggaggaataatgggaattaacagaaaggga
caagttctttccgtctctatcgatgaagctaacttggttccgttcgttacgaaccagctg
caaaatccagatttggctttgaagttggccgtgcgttgtgatctgcctggagctgaagag
ttgttcgttcgcaaattcaacttgttgttcagcaacggacagtttggagaatcagccaag
gttgctgcatcggctccacaaggaattttgagaacaccagccaccattcaaaagttccag
cagtgcccgtctactggtccaggaccatctccacttcttcaatatttcggaattcttctc
gatcaaggaaagttgaataaatacgaaacactcgagctgtgtcgtccggtcttggcacaa
ggaagaaaggagttgataacgaagtggctcaatgatcagaagttggagtgttgtgaagaa
ttgggagatctcattaagccgcacgatgtgaatactgctctttcagtctatttgcgtgga
aatgtcccgcacaaggttgttcaatcttttgctgaaactggacaattcgacaagatcgta
atgtatgccaagcgtgtcggattccaaccagactatttgttccaacttcgtcaaattctc
cgtaattcgaatcctgatcatggagcaaaattcgctcaacttcttgtctctgagagcgaa
aacggagaaccacttgctgatctttcacagatcattgactgtttcatggaggttcaagct
gttcaaccatgcacttcattccttctcgaagttttgaagggtgataagccggaggaagga
catctgcaaacgagacttcttgaaatgaatctgctcgctgccccagctgttgccgatgct
attctagccaacaagatgttctctcactacgatcgtgccgctatcggacaactctgcgaa
aaggctggacttcttcaaagagctctcgaacacttcactgacctctacgacattaagcga
actgttgttcacacccatcttctcaagcctgattggctcgttggatatttcggaagcctt
tctgttgaagattcggtcgaatgcttgaaagccatgctcactcagaatatccgacagaac
ctccaagtcgttgtgcagattgcatccaagtatcatgaacagctcggagctgacaagctg
attgagatgttcgaaaatcacaagtcatacgaaggtcttttctacttccttggttcgatt
gtcaacttcagccaggacccagaagttcacttcaagtacattcaagctgccacgcgcaca
gggcaaattaaagaggttgagcgtatctgtagagagtcgcaatgttatgatgccgaacgt
gtcaagaatttccttaaggaagccaagctcaacgatcaacttcctttgatcattgtctgc
gatcgtcataacatggttcatgatcttgttctttacctgtacagaaaccagctccagaag
tacattgaagtctttgttcaaaaggttaatgccgcccgtcttccgatcgttgttggtgct
cttctagatgttgattgtagtgaagatgctatcaaacaattgatcattaacactcgtgga
aagtttgacattgatgagcttgtcgaggaagttgagaaacgcaatcgtttgaagcttttg
aatcactggcttgaatcgaaaatccaggagggagcgactgatgctgctacccacaatgcg
atggccaagatttacatagattctaacaacaatcccgaacgattcttgaaggaaaatccc
tactacgatagcaaagttgttggaaagtactgcgaaaagcgtgatcctcactacgccttc
ttgtcatacgaacgcggacagtgcgacgctgaattgatcaacgtgtgcaacgagaattca
ctattcaagaatcttgcaagatatttggtgaagagaagagacttcactctgtgggagcaa
gttctcaacgaagagaatgttcatcgtagacagctgatagatcaagtggttcaaactgct
ctttccgaaactcaagatcccgaagacatctctgtgactgttaaggcattcatggctgcc
gatttgccgaacgaacttattgaacttttggaaaagattgttctcgataactctgcattc
tcggagcaccgtaatcttcaaaatctgctcattttgactgcaatgagagccgatagaact
cgtgtgatggagtacattcaaaagcttgacaactatgatgctccagatattgctaacatt
gctataacttctgaactctacgaagaagcgtttgccattttcaagaaattcgatgtgaac
tcaagtgccatcaatgttcttatcgagaacgtgaacaatttggatcgtgcttacgaattt
gctgaaaagtgcaaccagtcagatgtctgggcatctttagccaaggcacagctccaacaa
aatttggtgaaggaggctgtcgattcgtttatcaaggccgatgatccaggagcgtacatg
gaggttgtgaacaaatgttctcaaacggagcactgggaagatcttgttcgttaccttcaa
atggctcgcaagaagagtcgtgagtcatacatcgaaacggaactcgtttttgctctggcc
aagactggtcgtctcactgaacttgaagagtttatcgctggaccaaatcacgctcaaatc
ggacaaattggagatcgttgctttgacaatggaatgttcgattccgctaagatccttttc
aacaatgtttccaacttcgccaaactttccgttactcttgttcgtcttggagaatatcaa
ggagctgtcgatgctgcacgcaaagccaacagcacgaagacatggaaacaagtgtgcttc
tcttgtgtcgagaatggagagttccggcttgcccagatgtgtggacttcacatcgttgtc
cacgctgatgagcttgaggaattgatcaacttctaccaagatcgtggacatttcgaagag
ctcattgctcttctcgaagctgcattgggtcttgaacgggctcacatgggaatgttcacc
gaactcgcgattttgtactcgaagtataagccagagaagatgcgtgagcatttggaattg
ttctggagccgtgttaatattccaaaagttcttcgtgctgccgagcaggctcatctttgg
tccgagttggtgttcttgtacgataaatacgaagaatatgataacgccgcactgacaatg
atgcagcatccaactgaatcttggagagagcaacatttcaaggaagtcatcgctaaagtc
gctaatgttgagctatactacaaagcaatgcagttctacctggattataagccacttctc
ctgaatgaccttcttactgtgctatcgcctcggttggatcattcgcgcacagttttgttc
ttcaataagctgaagcaaatcccactggtcaagccttacttgagacaagttcaaaacttg
aacaacaaggctatcaacgaggctttgaatcagttgctcattgatgaggaggatcacgcc
gggcttcgttcttctattgaggctcaagacaactttgacaatatcactttggcccaacaa
cttgagaagcacccacttgtggaattcagaagaatttccgcatacttgttcaagggaaac
aacagatggaagcaatcgatcgagctttgcaaaaaagacaagctgtacaaggatgccatg
gaatacgctgcagaatcgagaaacggagaactcgccgaagagctcttgtcattcttcctg
gatgagaaactttatgattgttttgccgcctccctttaccattgttatgatctccttcac
cccgatgtcatcatggagctcgcttggaagcataagattatggattacgccatgccttac
atgatccaagttatgagagattatcagacgagacttgagaagttggagcgttctgagcat
gagaggaaagaggagaaggctgagcagcaacaaaacaatggaatgaccatggaaccacaa
cttatgcttacctatggtgcccctgccccacaaatgacttatccaggaacaactggtggc
tatggcggacagcctgcttacggtcaacctggacaaccaggatataatgcccctggattt
atgtaa

DBGET integrated database retrieval system