KEGG   Caenorhabditis elegans (nematode): CELE_T20G5.1Help
Entry
CELE_T20G5.1      CDS       T00019                                 

Gene name
chc-1
Definition
Protein CHC-1
Orthology
K04646  
clathrin heavy chain
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:cel00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CELE_T20G5.1 (chc-1)
   04142 Lysosome
    CELE_T20G5.1 (chc-1)
Exosome [BR:cel04147]
 Exosomal proteins
  Proteins found in most exosomes
   CELE_T20G5.1 (chc-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(10203872..10203994,10204042..10204162,10204214..10204578,10204625..10204804,10204913..10205773,10205818..10206120,10206168..10207322,10207369..10208590,10208643..10209221,10209270..10209406)
Genome map
AA seq 1681 aa AA seqDB search
MALPIKFHEHLQLPNAGIRVPNITFSNVTMESDKNIVVREMIGDQQQVVIIDLADTANPT
RRPISADSVIMHPTAKILALKSGKTLQIFNIELKAKVKAHQNVEDVVYWKWISEKTIALV
SDTAVYHWSIEGDAAPVKMFDRHQSLAGTQIINYRADAENKWLVLIGISAKDSRVVGSMQ
LYSTERKVSQPIEGHAACFVRFKVDGNQNPSNLFCFSVKTDNGGKLHVIEVGTPAAGNTP
FQKKNVDVPYTADTAGDFPVSMQVSAKQGIIYLVTKQGYVHLYDVESGTRIYSNRISTDT
VFVTCEYTATGGIMGINRKGQVLSVSIDEANLVPFVTNQLQNPDLALKLAVRCDLPGAEE
LFVRKFNLLFSNGQFGESAKVAASAPQGILRTPATIQKFQQCPSTGPGPSPLLQYFGILL
DQGKLNKYETLELCRPVLAQGRKELITKWLNDQKLECCEELGDLIKPHDVNTALSVYLRG
NVPHKVVQSFAETGQFDKIVMYAKRVGFQPDYLFQLRQILRNSNPDHGAKFAQLLVSESE
NGEPLADLSQIIDCFMEVQAVQPCTSFLLEVLKGDKPEEGHLQTRLLEMNLLAAPAVADA
ILANKMFSHYDRAAIGQLCEKAGLLQRALEHFTDLYDIKRTVVHTHLLKPDWLVGYFGSL
SVEDSVECLKAMLTQNIRQNLQVVVQIASKYHEQLGADKLIEMFENHKSYEGLFYFLGSI
VNFSQDPEVHFKYIQAATRTGQIKEVERICRESQCYDAERVKNFLKEAKLNDQLPLIIVC
DRHNMVHDLVLYLYRNQLQKYIEVFVQKVNAARLPIVVGALLDVDCSEDAIKQLIINTRG
KFDIDELVEEVEKRNRLKLLNHWLESKIQEGATDAATHNAMAKIYIDSNNNPERFLKENP
YYDSKVVGKYCEKRDPHYAFLSYERGQCDAELINVCNENSLFKNLARYLVKRRDFTLWEQ
VLNEENVHRRQLIDQVVQTALSETQDPEDISVTVKAFMAADLPNELIELLEKIVLDNSAF
SEHRNLQNLLILTAMRADRTRVMEYIQKLDNYDAPDIANIAITSELYEEAFAIFKKFDVN
SSAINVLIENVNNLDRAYEFAEKCNQSDVWASLAKAQLQQNLVKEAVDSFIKADDPGAYM
EVVNKCSQTEHWEDLVRYLQMARKKSRESYIETELVFALAKTGRLTELEEFIAGPNHAQI
GQIGDRCFDNGMFDSAKILFNNVSNFAKLSVTLVRLGEYQGAVDAARKANSTKTWKQVCF
SCVENGEFRLAQMCGLHIVVHADELEELINFYQDRGHFEELIALLEAALGLERAHMGMFT
ELAILYSKYKPEKMREHLELFWSRVNIPKVLRAAEQAHLWSELVFLYDKYEEYDNAALTM
MQHPTESWREQHFKEVIAKVANVELYYKAMQFYLDYKPLLLNDLLTVLSPRLDHSRTVLF
FNKLKQIPLVKPYLRQVQNLNNKAINEALNQLLIDEEDHAGLRSSIEAQDNFDNITLAQQ
LEKHPLVEFRRISAYLFKGNNRWKQSIELCKKDKLYKDAMEYAAESRNGELAEELLSFFL
DEKLYDCFAASLYHCYDLLHPDVIMELAWKHKIMDYAMPYMIQVMRDYQTRLEKLERSEH
ERKEEKAEQQQNNGMTMEPQLMLTYGAPAPQMTYPGTTGGYGGQPAYGQPGQPGYNAPGF
M
NT seq 5046 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcccaatcaaatttcacgagcacctgcagcttccgaatgctggaattcgggtg
cccaacattacattctccaatgtcacaatggaatctgataagaacattgttgttcgtgag
atgattggtgatcaacaacaggttgtgattattgatttggccgacacagcgaatccaact
cgtcgtccaatttctgctgactcagtaatcatgcacccaactgccaaaattcttgctttg
aaatctggcaagacacttcaaattttcaatattgagttgaaagcaaaagtgaaagctcat
cagaatgtagaagatgtagtttattggaagtggatcagtgagaaaacgattgcactcgtt
tccgacacagccgtctatcattggtcgatcgagggtgatgcagctccagtcaagatgttc
gatagacatcagtcgttggccggaactcaaatcataaattatcgcgctgatgccgaaaac
aagtggctcgttcttattggaatttccgcaaaagactcccgtgtcgttggaagtatgcaa
ttgtacagtaccgagagaaaagtatcgcagccaatcgaaggccatgccgcttgcttcgtt
cgattcaaggtcgatggaaaccaaaacccatctaacttattctgtttttccgtcaaaacc
gataatggaggaaaattgcacgttattgaagtaggaaccccagctgctggaaacactcct
ttccaaaagaagaatgttgatgttccatataccgctgacacagctggcgattttccagtg
tctatgcaggtatctgcgaagcaaggaattatttacctggtaacaaagcaaggatatgtt
catctttatgatgtcgagtctggaacacggatttattcgaatcgaatttcgactgatacc
gtatttgtgacctgtgaatacacagctacaggaggaataatgggaattaacagaaaggga
caagttctttccgtctctatcgatgaagctaacttggttccgttcgttacgaaccagctg
caaaatccagatttggctttgaagttggccgtgcgttgtgatctgcctggagctgaagag
ttgttcgttcgcaaattcaacttgttgttcagcaacggacagtttggagaatcagccaag
gttgctgcatcggctccacaaggaattttgagaacaccagccaccattcaaaagttccag
cagtgcccgtctactggtccaggaccatctccacttcttcaatatttcggaattcttctc
gatcaaggaaagttgaataaatacgaaacactcgagctgtgtcgtccggtcttggcacaa
ggaagaaaggagttgataacgaagtggctcaatgatcagaagttggagtgttgtgaagaa
ttgggagatctcattaagccgcacgatgtgaatactgctctttcagtctatttgcgtgga
aatgtcccgcacaaggttgttcaatcttttgctgaaactggacaattcgacaagatcgta
atgtatgccaagcgtgtcggattccaaccagactatttgttccaacttcgtcaaattctc
cgtaattcgaatcctgatcatggagcaaaattcgctcaacttcttgtctctgagagcgaa
aacggagaaccacttgctgatctttcacagatcattgactgtttcatggaggttcaagct
gttcaaccatgcacttcattccttctcgaagttttgaagggtgataagccggaggaagga
catctgcaaacgagacttcttgaaatgaatctgctcgctgccccagctgttgccgatgct
attctagccaacaagatgttctctcactacgatcgtgccgctatcggacaactctgcgaa
aaggctggacttcttcaaagagctctcgaacacttcactgacctctacgacattaagcga
actgttgttcacacccatcttctcaagcctgattggctcgttggatatttcggaagcctt
tctgttgaagattcggtcgaatgcttgaaagccatgctcactcagaatatccgacagaac
ctccaagtcgttgtgcagattgcatccaagtatcatgaacagctcggagctgacaagctg
attgagatgttcgaaaatcacaagtcatacgaaggtcttttctacttccttggttcgatt
gtcaacttcagccaggacccagaagttcacttcaagtacattcaagctgccacgcgcaca
gggcaaattaaagaggttgagcgtatctgtagagagtcgcaatgttatgatgccgaacgt
gtcaagaatttccttaaggaagccaagctcaacgatcaacttcctttgatcattgtctgc
gatcgtcataacatggttcatgatcttgttctttacctgtacagaaaccagctccagaag
tacattgaagtctttgttcaaaaggttaatgccgcccgtcttccgatcgttgttggtgct
cttctagatgttgattgtagtgaagatgctatcaaacaattgatcattaacactcgtgga
aagtttgacattgatgagcttgtcgaggaagttgagaaacgcaatcgtttgaagcttttg
aatcactggcttgaatcgaaaatccaggagggagcgactgatgctgctacccacaatgcg
atggccaagatttacatagattctaacaacaatcccgaacgattcttgaaggaaaatccc
tactacgatagcaaagttgttggaaagtactgcgaaaagcgtgatcctcactacgccttc
ttgtcatacgaacgcggacagtgcgacgctgaattgatcaacgtgtgcaacgagaattca
ctattcaagaatcttgcaagatatttggtgaagagaagagacttcactctgtgggagcaa
gttctcaacgaagagaatgttcatcgtagacagctgatagatcaagtggttcaaactgct
ctttccgaaactcaagatcccgaagacatctctgtgactgttaaggcattcatggctgcc
gatttgccgaacgaacttattgaacttttggaaaagattgttctcgataactctgcattc
tcggagcaccgtaatcttcaaaatctgctcattttgactgcaatgagagccgatagaact
cgtgtgatggagtacattcaaaagcttgacaactatgatgctccagatattgctaacatt
gctataacttctgaactctacgaagaagcgtttgccattttcaagaaattcgatgtgaac
tcaagtgccatcaatgttcttatcgagaacgtgaacaatttggatcgtgcttacgaattt
gctgaaaagtgcaaccagtcagatgtctgggcatctttagccaaggcacagctccaacaa
aatttggtgaaggaggctgtcgattcgtttatcaaggccgatgatccaggagcgtacatg
gaggttgtgaacaaatgttctcaaacggagcactgggaagatcttgttcgttaccttcaa
atggctcgcaagaagagtcgtgagtcatacatcgaaacggaactcgtttttgctctggcc
aagactggtcgtctcactgaacttgaagagtttatcgctggaccaaatcacgctcaaatc
ggacaaattggagatcgttgctttgacaatggaatgttcgattccgctaagatccttttc
aacaatgtttccaacttcgccaaactttccgttactcttgttcgtcttggagaatatcaa
ggagctgtcgatgctgcacgcaaagccaacagcacgaagacatggaaacaagtgtgcttc
tcttgtgtcgagaatggagagttccggcttgcccagatgtgtggacttcacatcgttgtc
cacgctgatgagcttgaggaattgatcaacttctaccaagatcgtggacatttcgaagag
ctcattgctcttctcgaagctgcattgggtcttgaacgggctcacatgggaatgttcacc
gaactcgcgattttgtactcgaagtataagccagagaagatgcgtgagcatttggaattg
ttctggagccgtgttaatattccaaaagttcttcgtgctgccgagcaggctcatctttgg
tccgagttggtgttcttgtacgataaatacgaagaatatgataacgccgcactgacaatg
atgcagcatccaactgaatcttggagagagcaacatttcaaggaagtcatcgctaaagtc
gctaatgttgagctatactacaaagcaatgcagttctacctggattataagccacttctc
ctgaatgaccttcttactgtgctatcgcctcggttggatcattcgcgcacagttttgttc
ttcaataagctgaagcaaatcccactggtcaagccttacttgagacaagttcaaaacttg
aacaacaaggctatcaacgaggctttgaatcagttgctcattgatgaggaggatcacgcc
gggcttcgttcttctattgaggctcaagacaactttgacaatatcactttggcccaacaa
cttgagaagcacccacttgtggaattcagaagaatttccgcatacttgttcaagggaaac
aacagatggaagcaatcgatcgagctttgcaaaaaagacaagctgtacaaggatgccatg
gaatacgctgcagaatcgagaaacggagaactcgccgaagagctcttgtcattcttcctg
gatgagaaactttatgattgttttgccgcctccctttaccattgttatgatctccttcac
cccgatgtcatcatggagctcgcttggaagcataagattatggattacgccatgccttac
atgatccaagttatgagagattatcagacgagacttgagaagttggagcgttctgagcat
gagaggaaagaggagaaggctgagcagcaacaaaacaatggaatgaccatggaaccacaa
cttatgcttacctatggtgcccctgccccacaaatgacttatccaggaacaactggtggc
tatggcggacagcctgcttacggtcaacctggacaaccaggatataatgcccctggattt
atgtaa

DBGET integrated database retrieval system