KEGG   Caenorhabditis elegans (nematode): CELE_T22H6.2Help
Entry
CELE_T22H6.2      CDS       T00019                                 

Gene name
alh-13
Definition
Protein ALH-13, isoform B
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cel01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cel00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(12782341..12782412,12782458..12782564,12783322..12783478,12784348..12784469,12784635..12784887,12785005..12785380,12785453..12786000,12786051..12786513,12786619..12786929)
Genome map
AA seq 802 aa AA seqDB search
MFRATRCLRLPLRNSHINILRPTQTELIKTRSSALAPYEKVSPITAVGATPVGVGNGNYC
YSTKTRQKHPLINTRNDLKKAQRVVVKLGSAVITREDECGLALGRLASIVEQVSELQQSG
RQMLIVSSGAVAFGRQKLRQELVMSMSMRQTLRGPSGMTADKRACAASGMPGLMSLYEQL
FQQYGITVAQVLLTKPDIDDDQRRKNLQATIESLLSLNIIPIVNANDAVAPDPKLNMHIS
DNDSLAARLSAEIEAELLIILSNVNGVYTGPPDLEGSRLLYTYVPSENSGVTFGANSKFG
TGGMESKVTACVNALNNGVTTVITNGLAQDAITDAVAGKKIGTMFCNTKGYEGPPIEEVA
EKCRDAGRQLAALSNKERGAMVRHLAALLVDKEKYIIEANQTDLANAKSAGLDPQLLNRL
KMTPEKIQDLHAGLNTIADSAETLVGRVLKKVKISEGLFLEQVTVPIGSLMVIFESRPDC
LPQVASLAMASGNALLLKGGKEAEESNKALHALVQEALGTHGFEMRDAVTLVRSREDVAD
LLQLKDLIDLIIPRGSSDLVRSMQEKSKGIPVLGHAEGVWHVYIDKDCDEQKAIQIVRDS
KCDYPSACNAAETILIHKDLATAPFFDSLCSMFKAEGVKLHAGPKLAALLKFAPPPAESM
SFEYGSLECTLEVVDNVEEAVAHIIRYGSGHTESIITENTNTAEHFLKHVDSACAFHNAS
TRFADGYRFGLGAEVGISTGRIHARGPVGVEGLLTTKWLLRGEGHLVEDFKNGKYSYLHE
NLNPSEVYRALDAAGELKKATA
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcgcaactcgatgtctgcgacttccactcagaaactcgcatattaatattctc
cgcccaacacagacggaacttattaaaacgagatcatcagcattggcaccatacgagaaa
gtaagcccaatcacagcagtaggagcaactccagttggagttggaaatggaaattactgt
tacagcacaaagacaaggcagaagcatccactcatcaacacgagaaatgacttgaaaaaa
gcgcaaagagttgttgtgaagctcggaagtgcagtgatcacacgtgaggacgagtgtggt
ctcgcacttggacgattggcttcaattgttgaacaggtttccgagctccaacagtctgga
agacagatgcttattgtgtcatcaggtgctgtggcattcggaagacaaaaacttcggcaa
gaacttgtaatgagcatgagcatgcgacaaactctcagaggtccatctggaatgactgct
gataaaagagcgtgtgcagcatctggaatgccgggactcatgtctctttatgaacaactt
ttccaacaatacggtattactgtagcacaagtcttattgaccaagccagacatcgatgat
gatcaaagaagaaagaatctacaggctacaattgaaagccttctttcactcaacattatc
ccaattgtcaacgcaaatgacgcagtggcaccagatccaaagttgaatatgcatatttcc
gacaatgactcacttgctgcgaggctttccgctgaaattgaagcagagctacttataatt
ttatcgaacgtcaatggagtttatactggaccaccagatctcgaaggatctagacttctc
tacacatacgttccatctgaaaactcgggggtcacgtttggagcaaacagcaaatttgga
acaggaggaatggagagcaaggttacggcctgtgtaaacgctcttaacaacggagttacc
acagttattacaaatgggctcgcgcaagatgctatcaccgatgctgtggcgggaaagaag
atcggaaccatgttctgcaacaccaaggggtatgaaggaccaccaatcgaggaggtcgca
gagaaatgccgcgacgctggtcgtcaactagctgctctttccaacaaagaacgtggtgca
atggttcgccacctcgctgctctcctggttgacaaggaaaaatatatcatcgaagctaat
caaactgatcttgccaatgccaaatctgctggactcgatccacaactcctgaatagattg
aaaatgacaccagagaagattcaagacttgcatgctggccttaatacaattgccgactcc
gcagagacacttgttggaagagttctcaagaaggtcaaaatttctgagggcctatttcta
gagcaggtcactgttccaatcggtagcctaatggttattttcgaatcacgcccggattgt
cttccacaagtcgcttcacttgctatggcttcaggaaatgcacttcttcttaagggagga
aaagaagctgaagaaagcaacaaagcattgcatgctcttgttcaggaagctcttggaaca
catggatttgaaatgagggacgcggttactttggtcagatcaagagaagatgtggcggat
ttgcttcagctcaaggatcttatcgacttgatcattccaagaggatcatccgacttggtg
cgttcaatgcaagaaaaaagcaagggaattccagtgttgggtcacgccgaaggtgtttgg
cacgtttacattgacaaggactgtgacgagcagaaggccattcaaattgttcgcgactcg
aaatgcgattatccatcagcgtgcaatgcagctgaaactattttgattcataaggatctt
gcaaccgcgccgttctttgattctttgtgctcaatgtttaaggcagaaggagtaaagctt
catgccggaccaaaacttgcagctcttctgaaatttgccccaccaccggcagagagcatg
tcattcgagtatggatcattggagtgtacgctcgaagttgttgacaatgttgaagaggcg
gttgcgcatattatccgttacggatccggtcatactgaatctattatcacagagaacacc
aacacagccgaacacttcctgaaacacgtagacagtgcgtgtgcattccataatgcctcc
actagatttgctgacgggtacagatttggtcttggagcagaagttggaatttctactgga
agaattcatgctcgtggaccagttggagttgaaggacttttgaccaccaaatggttgttg
agaggagaaggacatttggttgaagacttcaaaaatggaaaatactcttaccttcacgag
aatctcaacccaagcgaagtttatagagcattggatgctgctggagaattgaagaaagct
accgcataa

DBGET integrated database retrieval system