KEGG   Caenorhabditis elegans (nematode): CELE_T23F4.4Help
Entry
CELE_T23F4.4      CDS       T00019                                 

Gene name
nas-27
Definition
Protein NAS-27
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_T23F4.4 (nas-27)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_T23F4.4 (nas-27)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:complement(join(1176072..1176207,1176537..1176655,1176921..1177019,1177188..1177354,1177546..1177747,1178077..1178402,1178847..1179006,1179061..1179138))
Genome map
AA seq 428 aa AA seqDB search
MQILPIFFPLLITSLHAIPRGRRAVRNRNEGDINSLVGVGQYLYQGDIAVVKSRARRAVI
RQKHKKWKLPMPYSFDRNFPSRSRQRVLEAMQFWSEKTCVTFHENRYVYPHVSIFEGNGC
WSFVGKQPSLREQSLSLERSCTDHTFVVAHEIAHTLGFYHEHARGDRDQFISIDYSNVNP
NLTFAFAKESEKQLDHQEAAYEYGSVMHYSVDQFAVNTNRPVIYARDQKFAQAMGNRMRA
TFQDVSRMNVLYNCHERCANTLNRCQQGGYPAPSDCSQCVCPDGFGGNFCETIEAHSVGQ
KDNSDCGGVLWASETSQTFYGAVRTRVHSNSVLPTPEHCFWHIRASQGKSIEIQIKNIIS
PCSMSCSFNALELKLSNFTMTGPRFCCDEHIYNRYSQPKVFQSEGPLAVIGAYARYDYLD
FNIEYRAV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattcttccaattttcttcccactacttatcacttcgcttcacgcaattccacgt
ggtcggcgggcggttcggaaccgcaacgaaggagacatcaattccttagttggagtaggt
caatatctataccaaggggacattgcagtggtgaaatccagggctcggcgagccgtaatc
cgacagaagcacaaaaagtggaagcttccgatgccttactcttttgacaggaattttccc
tcccgttcccgacagcgagtccttgaagccatgcaattttggagtgaaaaaacatgtgta
acattccatgaaaatcgatatgtatacccccatgtgagcatattcgaaggaaatggatgc
tggagttttgttggaaagcagccaagtctccgcgagcagtcgttgtcactggagcgcagt
tgcaccgatcacacttttgtggtggcccatgagattgcacatactcttggattttatcat
gaacacgcaagaggcgatcgggatcaatttatatcgattgattattcgaatgttaacccg
aatttgacatttgcgtttgcaaaagaatccgaaaaacaactggaccatcaagaagcggct
tatgaatacggtagtgtgatgcactattcggtagatcagttcgccgtgaacaccaatcgc
ccggtgatctacgccagagatcaaaagttcgctcaggctatgggaaatcggatgagagcc
acgtttcaggatgtctcgaggatgaatgtgctttataattgtcatgaacgctgtgcaaac
accctaaaccggtgtcaacaaggcggctacccggctccgagcgactgctcccagtgtgtg
tgccccgatggttttggcgggaacttttgtgagactattgaggcccattcagtaggccag
aaggataattcggattgtggaggggtgttatgggcttccgaaacatctcaaaccttctac
ggagccgtgcgcaccagagtccactcgaactccgtcctaccaaccccggagcactgtttt
tggcatattagagcatcccaaggaaaatccatagagatccaaatcaagaacatcatctca
ccatgctccatgtcatgctcctttaatgctctggagctcaagctgtcaaatttcacaatg
acaggtcccagattctgctgcgacgagcacatctacaataggtactcccagccaaaagtc
ttccagtcagaaggtcccttagctgtaattggagcatatgctagatacgattatttggat
tttaatattgaatatcgtgctgtttag

DBGET integrated database retrieval system