KEGG   Caenorhabditis elegans (nematode): CELE_T23F4.4Help
Entry
CELE_T23F4.4      CDS       T00019                                 

Gene name
nas-27
Definition
Protein NAS-27
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:complement(join(1176079..1176214,1176544..1176662,1176928..1177026,1177195..1177361,1177553..1177754,1178084..1178409,1178854..1179013,1179068..1179145))
Genome map
AA seq 428 aa AA seqDB search
MQILPIFFPLLITSLHAIPRGRRAVRNRNEGDINSLVGVGQYLYQGDIAVVKSRARRAVI
RQKHKKWKLPMPYSFDRNFPSRSRQRVLEAMQFWSEKTCVTFHENRYVYPHVSIFEGNGC
WSFVGKQPSLREQSLSLERSCTDHTFVVAHEIAHTLGFYHEHARGDRDQFISIDYSNVNP
NLTFAFAKESEKQLDHQEAAYEYGSVMHYSVDQFAVNTNRPVIYARDQKFAQAMGNRMRA
TFQDVSRMNVLYNCHERCANTLNRCQQGGYPAPSDCSQCVCPDGFGGNFCETIEAHSVGQ
KDNSDCGGVLWASETSQTFYGAVRTRVHSNSVLPTPEHCFWHIRASQGKSIEIQIKNIIS
PCSMSCSFNALELKLSNFTMTGPRFCCDEHIYNRYSQPKVFQSEGPLAVIGAYARYDYLD
FNIEYRAV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattcttccaattttcttcccactacttatcacttcgcttcacgcaattccacgt
ggtcggcgggcggttcggaaccgcaacgaaggagacatcaattccttagttggagtaggt
caatatctataccaaggggacattgcagtggtgaaatccagggctcggcgagccgtaatc
cgacagaagcacaaaaagtggaagcttccgatgccttactcttttgacaggaattttccc
tcccgttcccgacagcgagtccttgaagccatgcaattttggagtgaaaaaacatgtgta
acattccatgaaaatcgatatgtatacccccatgtgagcatattcgaaggaaatggatgc
tggagttttgttggaaagcagccaagtctccgcgagcagtcgttgtcactggagcgcagt
tgcaccgatcacacttttgtggtggcccatgagattgcacatactcttggattttatcat
gaacacgcaagaggcgatcgggatcaatttatatcgattgattattcgaatgttaacccg
aatttgacatttgcgtttgcaaaagaatccgaaaaacaactggaccatcaagaagcggct
tatgaatacggtagtgtgatgcactattcggtagatcagttcgccgtgaacaccaatcgc
ccggtgatctacgccagagatcaaaagttcgctcaggctatgggaaatcggatgagagcc
acgtttcaggatgtctcgaggatgaatgtgctttataattgtcatgaacgctgtgcaaac
accctaaaccggtgtcaacaaggcggctacccggctccgagcgactgctcccagtgtgtg
tgccccgatggttttggcgggaacttttgtgagactattgaggcccattcagtaggccag
aaggataattcggattgtggaggggtgttatgggcttccgaaacatctcaaaccttctac
ggagccgtgcgcaccagagtccactcgaactccgtcctaccaaccccggagcactgtttt
tggcatattagagcatcccaaggaaaatccatagagatccaaatcaagaacatcatctca
ccatgctccatgtcatgctcctttaatgctctggagctcaagctgtcaaatttcacaatg
acaggtcccagattctgctgcgacgagcacatctacaataggtactcccagccaaaagtc
ttccagtcagaaggtcccttagctgtaattggagcatatgctagatacgattatttggat
tttaatattgaatatcgtgctgtttag

DBGET integrated database retrieval system