KEGG   Caenorhabditis elegans (nematode): CELE_T23H4.3Help
Entry
CELE_T23H4.3      CDS       T00019                                 

Gene name
nas-5
Definition
Protein NAS-5
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_T23H4.3 (nas-5)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_T23H4.3 (nas-5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:join(9886200..9886259,9886314..9886417,9886475..9886584,9886628..9886751,9886805..9886873,9887158..9887276,9887324..9887472,9887807..9888154)
Genome map
AA seq 360 aa AA seqDB search
MDIKQLLLSIILTVSVVNGRGRRINIYGAENGKSDIVQLRGPAEQLVYSSPIRERRPIFR
NALLSNSPLRWSKMQDLDGNYLIPYVISGNYDTVERDTIKTAMEKIANNTCIRLIPRTNQ
PDYAEINNKKGQGCYASIGRFPGKNVVMLESNDDQSCIQEDTVIHELFHVIGLWHEHMRA
DRDAFINVLYKNIEPAQYPQFEKLSSRDATTYSVPYDYNSVMHYDENAFAKPGKISMMTK
DSKFQKVIGHPKDASSNDYKKVCAIYHCSKCMHQDFQQIVEQEHIELNNPIITNAPVQQG
DSCTDRLGICPMLKSREMLNCKVMATFCCSSCSAPTSTTTTTSGTPSDGSLWQRIKSIFQ
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggacatcaaacagttattgttaagcattattttgactgtttcggtggtcaatggacgg
ggtcgacggatcaatatatatggtgctgaaaatgggaaaagcgatatagttcaactacgg
gggcctgcagagcaactagtttatagttcaccaatacgggaaaggaggcccatatttcga
aatgctcttctatcaaactcacctttacgatggagcaaaatgcaggatttggatggaaat
tatctaattccatatgttatatcgggcaattatgatactgtcgaaagagatacaatcaaa
actgcaatggaaaagattgcaaataatacatgtattcgattaattccgcgcacgaatcaa
cctgattatgcagaaattaataacaaaaagggtcaaggatgttatgcaagtattggtaga
tttcctggaaagaatgttgtgatgttggagagcaatgatgatcaatcatgcattcaagaa
gatacagtaatccatgagttatttcacgttattggcctgtggcatgaacatatgagagct
gatagagatgcttttattaatgttctctataaaaatattgagcctgcacaatatcctcaa
tttgagaagttgtcatctcgtgatgcaactacttacagtgttccatatgattataattct
gtaatgcattatgatgagaatgcttttgcaaaaccaggaaagattagtatgatgacaaag
gattcaaaatttcagaaagttattggtcaccccaaagatgcttctagcaatgactataag
aaagtgtgtgcaatctatcattgttccaaatgtatgcatcaagatttccaacaaattgtt
gagcaagaacatattgagttgaataatccaattattacaaatgcacctgtacaacaagga
gattcgtgtacagatcggttaggaatatgtccaatgttgaaatcaagagaaatgcttaat
tgtaaagtaatggctacattttgttgttcttcatgttctgcaccaacatctacaacaact
acaacatctggaactccatccgatggatcactttggcaaagaatcaaatcgatttttcaa
taa

DBGET integrated database retrieval system