KEGG   Caenorhabditis elegans (nematode): CELE_T24A11.3Help
Entry
CELE_T24A11.3     CDS       T00019                                 

Gene name
toh-1
Definition
Protein TOH-1
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:complement(join(3805090..3805204,3805313..3805434,3805668..3805756,3805802..3805927,3806236..3806695,3807364..3807443,3807950..3808037,3808832..3808996))
Genome map
AA seq 414 aa AA seqDB search
MTSSLVLILAPLALVAIGEAAFGNSSKIFEIPGLEVMASDKYPHFTTIETVSRTKVHRHR
REVIAGQIYDWNSYEIPFQIWGGDYNFQSLIRRGIRMWEDSTCLRFKENQQSRDAIRYVL
EKGDSCFTEYIGRNGGHQDIIIGSECAEEYVVAHETGHALGFWHTHQRPDRDRHISINWK
NVMEEATASFMPFRSMLQAFGIRQVSPRRVPYDYGSLMHYHAVAHAVKVSDFTIVPKELK
YVTTMGTEKMAFLDAKVINDIYCPNACQGRNHLNCLAGGYPDPNNCNVCRCPEGLGGPDC
GRLQPSPCGGEIHASDQWQTLSSPSGRDVHCYWRISVPEGSRVRFRLSDGEFPCSYGCQS
YVEIKHKLDVRLTGFRSCCYRPKEDTVSESNQIFVIYHPNGRTARFSLRFRRQA
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgacatcctcattggtgctaattcttgctccgttggcactggttgccatcggagaagcc
gcattcggcaatagctcgaagatctttgaaattccgggtctagaagtgatggcttctgat
aaatatccacatttcactacaattgagacagtcagcagaaccaaggttcatcgccaccga
cgcgaggtcattgccgggcaaatctacgactggaactcgtacgaaattccatttcaaata
tggggtggcgattataacttccaaagtttgatccgacgtggaattcgtatgtgggaagat
tcgacgtgcctgagatttaaagaaaatcaacagagccgtgacgcaatccgatatgttctc
gaaaaaggagacagttgtttcacagaatacattggccgaaacggaggacatcaagacatc
ataattggctccgagtgtgcagaagaatacgtagttgctcacgagaccgggcatgctctc
ggcttctggcacactcatcagcgacccgatagagatcggcatatctcgattaattggaag
aacgtgatggaggaagccactgcttcatttatgccgttccgatcaatgcttcaagcattc
ggtattcggcaggtctcgccacgaagggtaccgtacgattacggtagtctgatgcattat
catgcagttgctcatgcggttaaggtgtcggattttacgattgtaccaaaggaattgaag
tatgtcacaacgatgggaactgagaaaatggcattcctagatgcaaaagttatcaatgat
atttattgtccaaacgcatgccaaggaagaaatcatttgaactgtcttgctggaggttat
ccagatccaaacaactgcaacgtttgtaggtgtcctgaaggacttggaggacccgactgt
ggtcgacttcagccatcaccttgtggtggagaaattcatgcatctgatcaatggcagaca
ctctccagtccgtctggacgtgatgttcactgttattggaggatttctgtccccgaaggc
tcccgagttcgtttccgtttgtcagatggagaattcccatgctcctacggatgtcaatcg
tacgtcgaaatcaagcacaagcttgatgtaaggttgactggtttcagaagttgttgctac
cgtccaaaagaggacacagtctcggaaagcaatcaaatttttgtgatctaccatccaaat
ggccgtaccgcgcgattctccctccgattccgccggcaagcctaa

DBGET integrated database retrieval system