KEGG   Caenorhabditis elegans (nematode): CELE_T24A11.3Help
Entry
CELE_T24A11.3     CDS       T00019                                 

Gene name
toh-1
Definition
Protein TOH-1
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_T24A11.3 (toh-1)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_T24A11.3 (toh-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:complement(join(3805108..3805222,3805331..3805452,3805686..3805774,3805820..3805945,3806254..3806713,3807382..3807461,3807968..3808055,3808850..3809014))
Genome map
AA seq 414 aa AA seqDB search
MTSSLVLILAPLALVAIGEAAFGNSSKIFEIPGLEVMASDKYPHFTTIETVSRTKVHRHR
REVIAGQIYDWNSYEIPFQIWGGDYNFQSLIRRGIRMWEDSTCLRFKENQQSRDAIRYVL
EKGDSCFTEYIGRNGGHQDIIIGSECAEEYVVAHETGHALGFWHTHQRPDRDRHISINWK
NVMEEATASFMPFRSMLQAFGIRQVSPRRVPYDYGSLMHYHAVAHAVKVSDFTIVPKELK
YVTTMGTEKMAFLDAKVINDIYCPNACQGRNHLNCLAGGYPDPNNCNVCRCPEGLGGPDC
GRLQPSPCGGEIHASDQWQTLSSPSGRDVHCYWRISVPEGSRVRFRLSDGEFPCSYGCQS
YVEIKHKLDVRLTGFRSCCYRPKEDTVSESNQIFVIYHPNGRTARFSLRFRRQA
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgacatcctcattggtgctaattcttgctccgttggcactggttgccatcggagaagcc
gcattcggcaatagctcgaagatctttgaaattccgggtctagaagtgatggcttctgat
aaatatccacatttcactacaattgagacagtcagcagaaccaaggttcatcgccaccga
cgcgaggtcattgccgggcaaatctacgactggaactcgtacgaaattccatttcaaata
tggggtggcgattataacttccaaagtttgatccgacgtggaattcgtatgtgggaagat
tcgacgtgcctgagatttaaagaaaatcaacagagccgtgacgcaatccgatatgttctc
gaaaaaggagacagttgtttcacagaatacattggccgaaacggaggacatcaagacatc
ataattggctccgagtgtgcagaagaatacgtagttgctcacgagaccgggcatgctctc
ggcttctggcacactcatcagcgacccgatagagatcggcatatctcgattaattggaag
aacgtgatggaggaagccactgcttcatttatgccgttccgatcaatgcttcaagcattc
ggtattcggcaggtctcgccacgaagggtaccgtacgattacggtagtctgatgcattat
catgcagttgctcatgcggttaaggtgtcggattttacgattgtaccaaaggaattgaag
tatgtcacaacgatgggaactgagaaaatggcattcctagatgcaaaagttatcaatgat
atttattgtccaaacgcatgccaaggaagaaatcatttgaactgtcttgctggaggttat
ccagatccaaacaactgcaacgtttgtaggtgtcctgaaggacttggaggacccgactgt
ggtcgacttcagccatcaccttgtggtggagaaattcatgcatctgatcaatggcagaca
ctctccagtccgtctggacgtgatgttcactgttattggaggatttctgtccccgaaggc
tcccgagttcgtttccgtttgtcagatggagaattcccatgctcctacggatgtcaatcg
tacgtcgaaatcaagcacaagcttgatgtaaggttgactggtttcagaagttgttgctac
cgtccaaaagaggacacagtctcggaaagcaatcaaatttttgtgatctaccatccaaat
ggccgtaccgcgcgattctccctccgattccgccggcaagcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system