KEGG   Caenorhabditis elegans (nematode): CELE_T26A5.7Help
Entry
CELE_T26A5.7      CDS       T00019                                 

Gene name
set-1
Definition
(RefSeq) SET-1, isoform A
  KO
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CELE_T26A5.7 (set-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CELE_T26A5.7 (set-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
EnsemblGenomes-Gn: 
EnsemblGenomes-Tr: 
UniProt: 
Position
III:complement(join(6451353..6451490,6451579..6451766,6451821..6452059,6452193..6452356))
Genome map
AA seq 242 aa AA seqDB search
MKVAAKKLATSRMRKDRAAAASPSSDIENSENPSSLASHSSSSGRMTPSKNTRSRKGVSV
KDVSNHKITEFFQVRRSNRKTSKQISDEAKHALRDTVLKGTNERLLEVYKDVVKGRGIRT
KVNFEKGDFVVEYRGVMMEYSEAKVIEEQYSNDEEIGSYMYFFEHNNKKWCIDATKESPW
KGRLINHSVLRPNLKTKVVEIDGSHHLILVARRQIAQGEELLYDYGDRSAETIAKNPWLV
NT
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgccgcgaagaagctggcaacgagtagaatgcgaaaggatcgtgccgcagca
gcgtcaccatctagtgatattgagaactccgaaaatccatcgtctttggcttcacactct
tcatcttcaggaagaatgacaccgtcgaaaaacacaaggagcagaaaaggagtgtcggtg
aaagatgtctcaaaccataaaatcacagaattcttccaagtgcggcgaagtaatcggaag
acgagcaagcaaattagcgatgaagctaaacatgctcttcgcgataccgtactcaagggg
actaatgaacgacttcttgaagtgtacaaagatgttgtgaaggggcgaggaattcgaacg
aaagttaactttgaaaaaggagactttgttgtcgaatacagaggtgttatgatggagtac
tcggaagcaaaagtgatagaagaacaatattcgaatgatgaggaaatcggatcctacatg
tacttttttgagcacaacaataaaaaatggtgtatcgatgcgacaaaagaatctccatgg
aaaggacgactcatcaatcattccgtgttaaggccgaatctcaaaacgaaagtggtggaa
atcgatgggtcgcatcacctgattctcgtcgccaggcgtcaaatcgcacaaggagaagag
cttctctacgattatggagatcgttcagcagagacgattgccaagaatccatggcttgtg
aacacataa

DBGET integrated database retrieval system