KEGG   Caenorhabditis elegans (nematode): CELE_T26A5.7Help
Entry
CELE_T26A5.7      CDS       T00019                                 

Gene name
set-1
Definition
Protein SET-1, isoform A
Orthology
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cel00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:complement(join(6451301..6451438,6451527..6451714,6451769..6452007,6452141..6452304))
Genome map
AA seq 242 aa AA seqDB search
MKVAAKKLATSRMRKDRAAAASPSSDIENSENPSSLASHSSSSGRMTPSKNTRSRKGVSV
KDVSNHKITEFFQVRRSNRKTSKQISDEAKHALRDTVLKGTNERLLEVYKDVVKGRGIRT
KVNFEKGDFVVEYRGVMMEYSEAKVIEEQYSNDEEIGSYMYFFEHNNKKWCIDATKESPW
KGRLINHSVLRPNLKTKVVEIDGSHHLILVARRQIAQGEELLYDYGDRSAETIAKNPWLV
NT
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgccgcgaagaagctggcaacgagtagaatgcgaaaggatcgtgccgcagca
gcgtcaccatctagtgatattgagaactccgaaaatccatcgtctttggcttcacactct
tcatcttcaggaagaatgacaccgtcgaaaaacacaaggagcagaaaaggagtgtcggtg
aaagatgtctcaaaccataaaatcacagaattcttccaagtgcggcgaagtaatcggaag
acgagcaagcaaattagcgatgaagctaaacatgctcttcgcgataccgtactcaagggg
actaatgaacgacttcttgaagtgtacaaagatgttgtgaaggggcgaggaattcgaacg
aaagttaactttgaaaaaggagactttgttgtcgaatacagaggtgttatgatggagtac
tcggaagcaaaagtgatagaagaacaatattcgaatgatgaggaaatcggatcctacatg
tacttttttgagcacaacaataaaaaatggtgtatcgatgcgacaaaagaatctccatgg
aaaggacgactcatcaatcattccgtgttaaggccgaatctcaaaacgaaagtggtggaa
atcgatgggtcgcatcacctgattctcgtcgccaggcgtcaaatcgcacaaggagaagag
cttctctacgattatggagatcgttcagcagagacgattgccaagaatccatggcttgtg
aacacataa

DBGET integrated database retrieval system