KEGG   Caenorhabditis elegans (nematode): CELE_T27A3.2Help
Entry
CELE_T27A3.2      CDS       T00019                                 

Gene name
usp-5
Definition
Protein USP-5
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CELE_T27A3.2 (usp-5)
Peptidases [BR:cel01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CELE_T27A3.2 (usp-5)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_T27A3.2 (usp-5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:join(6110139..6110259,6110317..6110426,6110470..6110543,6110587..6110676,6110722..6111024,6111122..6111419,6111489..6111760,6112342..6112501,6112551..6112643,6112701..6112793,6112948..6113208,6113252..6113470,6113645..6113833,6114236..6114322)
Genome map
AA seq 789 aa AA seqDB search
MDVETAVRSAVDAGAFIRPTFDQKIFKDQCAYCFKDPHGKDGLYISLKNYHAFCREHAEI
YGTTSGNTLFVQFESTKKIIEERTDGEPTSKMTKLTIDSDPKFEFEDKYCVVVHPEYSQQ
VKNVQNLPEIAEAIAQIANTTSAERLSLLSSTSNAWDAEIKLITKHQNLEQQDNGKHLAL
TGWTCEVEGCGLNDNLWLNLTDGAVRCGRSQFLSDGKKTNGNGHMQDYFDSTRFPLVVKL
GTISSNLELIDVYSYDEDDAVIDPNLEKHLKHFGLDPTKMEKTAKSTMEMELDMNEKWEW
SKCTEDGLLLEPIFGPGYTGLVNTGSSCYMNSVLQALVTVDSFQTRYGEQGLETLVNCPL
DKLHNDFNAQFSKVVRAMLSGDYSSEMDPTNNHIKPLQFKRVAAGNHRDFSTSKQQDVEE
YIRFLFEKIAENSRTEVIDPTDSFKFKAINRFEDRGTRRVRYTDQEEMLIRLPISGDLLR
PIPDTENRYSVDMKAAIHAYFDVQKIDDYISPITGEPKGATNTISMKTFPDYLFFQVSKF
AYNVDGTQKKLDMELEIEEELDLSGYRGHGKLEHEIALPDEEPTAPRTTPDIPASVRFVA
GELMLMGFCENACYRAAYYSNGNVEIASNWLMEHMDDSDINDLFVIPSGTPSARGEVDPN
LVASIVEMGFSNHQAKYALKQVPTVAEAVEWLFANMDSIPVESAAVGLSSDAPEPSVTES
ATQKTFKDGGEKYKLIGMISHMGSRPDSGHYVAHMLKEGKWVLFNDEKVALSQDPPKKLA
YVYLYKRIA
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcgaaaccgccgttcgttctgctgttgatgccggcgcgttcattcgtccaact
ttcgaccagaaaatcttcaaggatcagtgcgcgtactgtttcaaagacccacacggaaaa
gatggtctctacattagtctgaagaactatcacgctttttgccgcgagcacgcagaaatc
tacggaacaacctctggaaacactctttttgtacaatttgagtccacaaagaaaataatt
gaagaaagaaccgatggggagccaacgagcaagatgaccaagctcacaatcgattcagat
ccaaagtttgaatttgaggacaaatactgtgttgttgttcacccagaatactcgcagcag
gtgaaaaatgtgcagaatcttccggaaattgctgaagcaattgcacaaattgccaacacg
acaagtgccgaacgcctgtcacttctctcatcaaccagtaatgcgtgggatgccgagatc
aagcttatcactaagcatcaaaatctcgagcaacaagacaacggaaagcacctcgctctt
actggatggacttgtgaagttgagggatgcggacttaatgataatctgtggctcaatttg
accgatggagctgtacggtgtgggcggagccaatttttgtccgatgggaagaagacgaat
ggaaatggacatatgcaagattatttcgattctacgagattcccacttgtggtaaagctc
gggacaatctcctcaaaccttgaattgattgatgtctacagttatgatgaagacgatgca
gttattgatccaaatttggagaagcatctgaaacatttcggacttgacccaacaaaaatg
gagaaaactgcgaaaagtacgatggagatggaattggatatgaatgagaagtgggaatgg
tcaaaatgcacagaggatggtcttttattggaaccaatatttggaccaggatatacggga
cttgtgaatactggaagcagttgttatatgaattcagttcttcaagctcttgtcacagtc
gactcattccaaactcgttacggtgagcagggtctcgagacgcttgtcaactgtccactt
gacaaacttcacaatgatttcaacgctcaattttcaaaagttgtccgcgcgatgctcagt
ggtgactattcatccgaaatggatccgactaataatcacatcaaaccgcttcaattcaaa
cgagttgctgctggaaatcatcgagatttctccacttcgaagcaacaagatgttgaggaa
tatattcgtttcctcttcgagaaaatcgccgaaaactcgagaaccgaagtgattgaccca
accgattcgttcaaattcaaagcaatcaatcgcttcgaggatagaggaactcgtagagtc
agatacactgatcaggaggaaatgctcattcgtcttccaatttctggggatcttctacgc
ccgattccggacactgaaaatcgttattcggtcgacatgaaagctgcaattcatgcatat
tttgatgttcaaaagattgatgactatatatcaccaatcactggagaaccaaaaggagcc
accaacactatttctatgaagactttccccgattatttgttcttccaagtttcgaaattc
gcttacaacgtcgacggaactcaaaagaaacttgacatggagctggaaatcgaagaggaa
ttggatctcagtggatatcgaggacatggaaagttggaacatgagattgctcttccagat
gaggaaccaactgctccacgaacaactccagatattccagcaagtgttcgttttgttgct
ggagagcttatgttgatgggattctgtgagaatgcgtgctacagagcagcttattattcc
aatggaaatgtggagattgcatcaaactggctcatggagcatatggacgactctgatatc
aatgatttgtttgtgattccatctggaactccatcagctcgtggagaagtcgatccgaat
cttgtcgcgtcgattgttgaaatgggattctctaatcatcaagcaaagtatgctttgaag
caggtgccgactgttgcagaggctgttgaatggctttttgccaatatggatagtatccca
gtagagtcagccgccgtcggtctaagctcggatgctccagagccgtctgtcacagaatcg
gcaactcaaaagacattcaaggatggtggagagaaatataagttgattgggatgatttct
catatgggatcacgtcctgattctggtcattacgtagctcacatgctcaaagagggaaaa
tgggttctcttcaatgacgaaaaagttgcactctcccaggatccaccaaaaaagttggcc
tatgtctacctgtacaagcgaatcgcctaa

DBGET integrated database retrieval system