KEGG   Caenorhabditis elegans (nematode): CELE_T28F12.3Help
Entry
CELE_T28F12.3     CDS       T00019                                 

Gene name
sos-1
Definition
(RefSeq) Son of sevenless homolog
  KO
K03099  
son of sevenless
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CELE_T28F12.3 (sos-1)
   04012 ErbB signaling pathway
    CELE_T28F12.3 (sos-1)
   04068 FoxO signaling pathway
    CELE_T28F12.3 (sos-1)
   04150 mTOR signaling pathway
    CELE_T28F12.3 (sos-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
WormBase: 
UniProt: 
Position
V:complement(join(4517682..4517811,4518431..4518544,4518599..4518773,4519908..4520171,4521760..4522039,4522469..4522591,4536192..4536326,4537162..4537581,4539158..4539286,4539335..4539415,4540666..4541719,4542422..4542500,4542555..4542804,4543528..4543926,4545865..4546116,4547570..4547872,4548824..4548910,4549021..4549107,4549160..4549279))
Genome map
AA seq 1493 aa AA seqDB search
MSIMSISLHSASSDTVSLTSRRTISTSKHWAAIFDERIYQICNIVHPGLPIDNAAVEHIR
YFLQSIVFELIEARATSVVEVDKTAKKLFAFGLQTVCKEAWDNMHQQLQKHKYQKALKTV
LESQHRLAAVIKETLGPREKEKKDREKKEIERIACYIYYACESVTEDVLRLTGNYVKNIR
NSEQKITMANLDVAMNGDKALMELRTKLRNEEEAESPGGFGFLSEFEEFVAEETEEKTLS
NSQTYESVAVDFLRDERRFIRELNRINVFRRRIESVAATDVDKQIVCNLFGNLTEIHDLA
LKIERTLEDAIELSDTQCIGMGIWEHGEAYEFDTYTFYIRRDGGEMNETRHATYVINDNI
KALLESERFASLFQSGEHYLGSSLDGQSFRLAVQYVLPQLLHIPIFHIYQYHEYITRLHQ
LSSSEEDRRDLNDCRSAFERVVGCVSDMSPELKTKITQFLDQQAKSEKIYNVKRLNEIQS
SIDGFTGSPIGKTCNELEKDGDLGMIRPSLQFSSEITKNKKWKTERFVYIFDQMIVLCKR
HRNTLKFKDRLAVHSIDVFDIPDSEVTNCFKIESHDKSSLPKIYHFVCKNPEEKRQWMAV
LVKVTTKSVLDRILDNHEKEEAKRIPLVVPGPDQYRFSEPDTEDNISFEDYTSSSGIPVI
KCGTVLKLIERLTYHSYTDSKYILTFLISYRSFCTPNDLFSLLLERFNIPTPKKLQQPKQ
GGGPLAGRYDTVQSHGLSAISSSSCINPLCEQKFRKEFQQPIQLRVLSVINQWVKLHWYD
FQCDPVLLDALELFLNRCCDPREGLSKQHKKFCKTILALIEKRVKNPPGIMQQPNENGDK
GAADEGHVNSAFVFGDDQQHPPQHQVYTNESPKETNQVLWHTAQKGDVDHYDLLTLHPIE
IGRQLTLLHSDLYRAIQPIELVEAAWTKAEKWRKSPQLLRLTDHSTLLTYWVSRSIVETE
SLEERMAMFNRVLEVMSVFEELHNFTGLVAFYSALNSSCIFRLKWCWDGLDNEKKKCFDR
FNTLCERRWQEMQKRLSSINPPCIPFFGHYLSNIYFLEQGNSTFVNKSPPHGAAGAQKQQ
KDDLKASDPENSNKQFKQLVSFLKLRKISNVIREIQIFQDQRYSLTLEPTIRQFFESINP
KNDFKSNEDLEEYLYNKSLEIQPKGLDTPTAELKPKHNASTLRSPGVKPPKAAGNHYSAN
HPIGLHLHSQNSHSAPHAMSSQSSTVPNTPLSAHETKRSLSHNQDDAPLQQFVDIRFERK
GTHPKIPVLQPPPLLPRSSRANQSNSVSLPPTTQAPMPPAPKSSGMMSTATSPTTLTTTT
TPSSAGGPPPKLHPRRMTQQPMSPLAKSPLTPSRDNSSPSAFQFPVVYEASTAPPLPPRP
STSSDVSSSPSTSGSTSSATKENQEQLRVIFDREESHSPTVRLSVPLPPALPPPRGSSVF
RAPPPLPPKSNRHNSNSPTLSSEQPFEDPMSPSIFVNTPPPPLPPKTYRSSNK
NT seq 4482 nt NT seq  +upstreamnt  +downstreamnt
atgagcataatgagcatatcactgcactcggcatcatcggatacggtctcgttgaccagc
cgacgaacaatatcaactagtaagcattgggcggctatttttgatgaaagaatttatcag
atatgcaatatcgtacatcctggcctcccgattgacaatgctgcagttgagcacattcga
tattttttgcaaagtatcgtttttgagctcatcgaagcacgtgccacaagtgtcgtcgaa
gtggacaaaactgcgaaaaagctgttcgcattcggtctgcagactgtttgtaaagaagcc
tgggacaacatgcaccaacaactccaaaagcacaaatatcaaaaagccctgaaaacagtt
ctagaaagccaacatcgcctggcagcagtcatcaaagaaacacttggaccacgagaaaaa
gagaaaaaagatcgagaaaagaaggaaatcgaacgtatcgcatgctatatttattatgca
tgtgaaagtgttactgaagatgtgctcaggctgactggaaattatgtgaaaaatattcga
aatagtgagcaaaagattacgatggctaatcttgatgtggcgatgaacggggataaggcc
ctaatggagctccgaacaaaacttcgaaacgaggaggaagccgaatctcccggcggtttt
ggttttctatcggaatttgaggaatttgttgccgaagagactgaagaaaagaccctatcg
aatagtcagacatatgaatcagtagctgttgattttttgagagatgagagacgatttatt
cgtgaattgaataggattaatgtatttcgacggagaatcgaatcggttgcggcgacggat
gttgataagcaaatcgtgtgcaacctgttcggaaatctcactgagatccacgatcttgct
ctgaaaatcgaacgaaccctcgaagatgccatcgagctcagcgatactcaatgtattgga
atgggaatttgggagcacggagaagcttatgaattcgatacctatacattctatataaga
agagatggtggagaaatgaatgagacacgacacgcgacatatgtgattaatgataatatt
aaagcattgctggaaagtgaacgattcgcctcgttattccaatcgggagaacattatttg
ggaagctcgttggatggacaaagttttcgattagctgtacaatatgtgttgcctcagttg
ttgcatattcccatttttcatatttatcagtatcatgagtatattactcgcctccaccaa
ctcagttccagtgaagaagatcgtcgtgatctgaatgattgtcgttcagcattcgaacgt
gtcgttggatgtgtatccgatatgtctcctgaattgaaaactaaaatcacacaatttctg
gatcagcaggcaaaaagtgaaaagatttataatgtgaaaagactgaatgaaattcaatcg
tcaattgatggatttaccggtagtccgattggaaaaacgtgcaatgaattggaaaaagac
ggtgatctgggaatgattcggccatctcttcaattttcaagtgaaattacgaagaataaa
aagtggaaaacggaaagattcgtctacatcttcgaccaaatgatagtgctctgcaaacga
caccggaatacactaaaattcaaagatcgcctagccgttcattcgatcgacgtctttgat
attccagattccgaagtcacaaattgctttaaaatcgaatcacacgacaaatcaagcctc
cccaaaatctatcattttgtgtgtaaaaatcccgaagaaaaacgccaatggatggctgtt
ctggtgaaagtgacgacgaaaagcgtgctcgacagaattctagacaatcacgaaaaggaa
gaggcaaagaggatcccacttgtcgtgccaggacccgatcagtatcgattttcagagcca
gatacagaggataacatttctttcgaggattacacgtcgagcagtggtatccctgtgata
aagtgtggaactgttctgaagctgattgaacgactgacatatcattcttatacggatagc
aagtatattctgacatttctcatctcatatcggtcattttgtactccgaatgatttgttt
agtcttcttctcgaacgatttaatattccaactcctaagaagcttcaacaaccgaaacaa
ggtggcggtccactagctggtcgttatgatactgtccaatctcatggactatccgcaatt
tctagttcatcatgtatcaatccactctgcgagcagaaattccgaaaagagttccaacaa
ccgattcagctccgagttttgagtgtcatcaatcaatgggtcaaacttcattggtacgat
ttccagtgtgatcctgtacttctagatgctcttgaactatttctgaatagatgttgtgat
ccgagggaagggctcagtaaacagcataagaagttttgcaagacgatattggcgttgatt
gagaaacgagtcaagaatccgccgggaatcatgcaacagccgaatgagaatggggataag
ggagccgctgatgagggtcatgttaatagtgcatttgtgtttggtgatgatcaacaacat
ccgccacaacatcaagtgtatactaatgagagtcccaaggagaccaatcaggttctctgg
cacactgctcaaaaaggagacgtcgatcattacgatctgctcacactgcatccaatcgaa
attggaagacagttaactctgcttcactccgacttgtaccgagctattcagccgattgag
ctcgtcgaagccgcgtggacgaaagctgagaaatggaggaaaagtccgcagttgttgaga
ttaaccgatcattctacactgttaacctactgggtatcccgatcaatagtggaaacggaa
tccctcgaagaacgtatggcaatgttcaacagagtacttgaagtgatgtcagtattcgaa
gaacttcataatttcacgggtctagtcgccttctactctgcactcaattcttcgtgtatt
ttccgattaaaatggtgttgggatgggttggataacgagaagaagaagtgtttcgatcga
ttcaatacactttgtgaacggcgttggcaagaaatgcagaaacgtctcagttcgattaat
cccccgtgtattccgttcttcggtcattatctttccaatatttattttttggagcaaggt
aacagcacatttgtcaacaagtcaccaccacatggtgctgccggtgcacaaaaacagcag
aaggacgatttgaaggcatcggatcccgagaattcaaacaagcaattcaagcaactggta
tcatttctgaagttgcggaaaatttcgaatgtgatccgtgagatccagatcttccaggat
caacggtactcgctgacgttggagccgacgattcgacaattcttcgagtcaataaaccca
aagaatgatttcaaaagcaatgaggatttggaagaatacctctacaacaagtcactcgag
attcaaccaaaaggcctcgacacgccaacggcagaattgaagccaaagcacaatgcctca
acactccgttctcctggagtaaaaccgccgaaagctgcaggaaatcactactcggcgaat
catccgatcggacttcatcttcattctcagaattcgcattcggcaccacacgcaatgtca
agccagtcgagtacggtgccaaatactccactcagcgcacatgagacgaagagaagcttg
tcacataatcaggacgatgctcctctccaacaatttgtcgatattcgatttgagagaaag
gggacgcatccgaaaattcctgtcctccaaccgccaccacttcttccacgttcatcacga
gccaatcaaagtaattcggtctcactgccacctactacacaagctccaatgccaccagct
ccgaagagttctggaatgatgagcactgcgacgagtccgacgacactgacgacgacgacg
actcctagctctgcaggtggaccaccaccgaagcttcatccaagacgtatgacacagcag
ccgatgtctccgttggcaaagtctccgttgactccttctagagacaactcatcaccatcg
gccttccaatttcccgttgtctacgaagcatcaacagcaccaccacttccacctcgtcca
tctacatcgtcagatgtgtcgtcatctcccagcacatctggatccacatcgtcagctacc
aaagaaaatcaagaacagctccgagtaatcttcgatcgcgaagaatcacattctccaacc
gtccgtctttctgtgccccttccaccagctcttcctccaccgagaggatcttccgtgttc
cgggcgccaccaccacttccaccaaaatcaaaccgtcacaacagcaacagtccaacactt
tcttcggagcaacctttcgaagatccaatgtctccatcgattttcgtcaacactccacca
ccgccgttgccaccaaagacttacagaagctctaataagtag

DBGET integrated database retrieval system