KEGG   Caenorhabditis elegans (nematode): CELE_T28F12.3Help
Entry
CELE_T28F12.3     CDS       T00019                                 

Gene name
sos-1
Definition
Protein SOS-1
Orthology
K03099  
son of sevenless
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CELE_T28F12.3 (sos-1)
   04012 ErbB signaling pathway
    CELE_T28F12.3 (sos-1)
   04630 Jak-STAT signaling pathway
    CELE_T28F12.3 (sos-1)
   04068 FoxO signaling pathway
    CELE_T28F12.3 (sos-1)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    CELE_T28F12.3 (sos-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(4517682..4517811,4518431..4518544,4518599..4518773,4519908..4520171,4521760..4522039,4522469..4522591,4536192..4536326,4537162..4537581,4539158..4539286,4539335..4539415,4540666..4541719,4542422..4542500,4542555..4542804,4543528..4543926,4545865..4546116,4547570..4547872,4548824..4548910,4549021..4549107,4549160..4549279))
Genome map
AA seq 1493 aa AA seqDB search
MSIMSISLHSASSDTVSLTSRRTISTSKHWAAIFDERIYQICNIVHPGLPIDNAAVEHIR
YFLQSIVFELIEARATSVVEVDKTAKKLFAFGLQTVCKEAWDNMHQQLQKHKYQKALKTV
LESQHRLAAVIKETLGPREKEKKDREKKEIERIACYIYYACESVTEDVLRLTGNYVKNIR
NSEQKITMANLDVAMNGDKALMELRTKLRNEEEAESPGGFGFLSEFEEFVAEETEEKTLS
NSQTYESVAVDFLRDERRFIRELNRINVFRRRIESVAATDVDKQIVCNLFGNLTEIHDLA
LKIERTLEDAIELSDTQCIGMGIWEHGEAYEFDTYTFYIRRDGGEMNETRHATYVINDNI
KALLESERFASLFQSGEHYLGSSLDGQSFRLAVQYVLPQLLHIPIFHIYQYHEYITRLHQ
LSSSEEDRRDLNDCRSAFERVVGCVSDMSPELKTKITQFLDQQAKSEKIYNVKRLNEIQS
SIDGFTGSPIGKTCNELEKDGDLGMIRPSLQFSSEITKNKKWKTERFVYIFDQMIVLCKR
HRNTLKFKDRLAVHSIDVFDIPDSEVTNCFKIESHDKSSLPKIYHFVCKNPEEKRQWMAV
LVKVTTKSVLDRILDNHEKEEAKRIPLVVPGPDQYRFSEPDTEDNISFEDYTSSSGIPVI
KCGTVLKLIERLTYHSYTDSKYILTFLISYRSFCTPNDLFSLLLERFNIPTPKKLQQPKQ
GGGPLAGRYDTVQSHGLSAISSSSCINPLCEQKFRKEFQQPIQLRVLSVINQWVKLHWYD
FQCDPVLLDALELFLNRCCDPREGLSKQHKKFCKTILALIEKRVKNPPGIMQQPNENGDK
GAADEGHVNSAFVFGDDQQHPPQHQVYTNESPKETNQVLWHTAQKGDVDHYDLLTLHPIE
IGRQLTLLHSDLYRAIQPIELVEAAWTKAEKWRKSPQLLRLTDHSTLLTYWVSRSIVETE
SLEERMAMFNRVLEVMSVFEELHNFTGLVAFYSALNSSCIFRLKWCWDGLDNEKKKCFDR
FNTLCERRWQEMQKRLSSINPPCIPFFGHYLSNIYFLEQGNSTFVNKSPPHGAAGAQKQQ
KDDLKASDPENSNKQFKQLVSFLKLRKISNVIREIQIFQDQRYSLTLEPTIRQFFESINP
KNDFKSNEDLEEYLYNKSLEIQPKGLDTPTAELKPKHNASTLRSPGVKPPKAAGNHYSAN
HPIGLHLHSQNSHSAPHAMSSQSSTVPNTPLSAHETKRSLSHNQDDAPLQQFVDIRFERK
GTHPKIPVLQPPPLLPRSSRANQSNSVSLPPTTQAPMPPAPKSSGMMSTATSPTTLTTTT
TPSSAGGPPPKLHPRRMTQQPMSPLAKSPLTPSRDNSSPSAFQFPVVYEASTAPPLPPRP
STSSDVSSSPSTSGSTSSATKENQEQLRVIFDREESHSPTVRLSVPLPPALPPPRGSSVF
RAPPPLPPKSNRHNSNSPTLSSEQPFEDPMSPSIFVNTPPPPLPPKTYRSSNK
NT seq 4482 nt NT seq  +upstreamnt  +downstreamnt
atgagcataatgagcatatcactgcactcggcatcatcggatacggtctcgttgaccagc
cgacgaacaatatcaactagtaagcattgggcggctatttttgatgaaagaatttatcag
atatgcaatatcgtacatcctggcctcccgattgacaatgctgcagttgagcacattcga
tattttttgcaaagtatcgtttttgagctcatcgaagcacgtgccacaagtgtcgtcgaa
gtggacaaaactgcgaaaaagctgttcgcattcggtctgcagactgtttgtaaagaagcc
tgggacaacatgcaccaacaactccaaaagcacaaatatcaaaaagccctgaaaacagtt
ctagaaagccaacatcgcctggcagcagtcatcaaagaaacacttggaccacgagaaaaa
gagaaaaaagatcgagaaaagaaggaaatcgaacgtatcgcatgctatatttattatgca
tgtgaaagtgttactgaagatgtgctcaggctgactggaaattatgtgaaaaatattcga
aatagtgagcaaaagattacgatggctaatcttgatgtggcgatgaacggggataaggcc
ctaatggagctccgaacaaaacttcgaaacgaggaggaagccgaatctcccggcggtttt
ggttttctatcggaatttgaggaatttgttgccgaagagactgaagaaaagaccctatcg
aatagtcagacatatgaatcagtagctgttgattttttgagagatgagagacgatttatt
cgtgaattgaataggattaatgtatttcgacggagaatcgaatcggttgcggcgacggat
gttgataagcaaatcgtgtgcaacctgttcggaaatctcactgagatccacgatcttgct
ctgaaaatcgaacgaaccctcgaagatgccatcgagctcagcgatactcaatgtattgga
atgggaatttgggagcacggagaagcttatgaattcgatacctatacattctatataaga
agagatggtggagaaatgaatgagacacgacacgcgacatatgtgattaatgataatatt
aaagcattgctggaaagtgaacgattcgcctcgttattccaatcgggagaacattatttg
ggaagctcgttggatggacaaagttttcgattagctgtacaatatgtgttgcctcagttg
ttgcatattcccatttttcatatttatcagtatcatgagtatattactcgcctccaccaa
ctcagttccagtgaagaagatcgtcgtgatctgaatgattgtcgttcagcattcgaacgt
gtcgttggatgtgtatccgatatgtctcctgaattgaaaactaaaatcacacaatttctg
gatcagcaggcaaaaagtgaaaagatttataatgtgaaaagactgaatgaaattcaatcg
tcaattgatggatttaccggtagtccgattggaaaaacgtgcaatgaattggaaaaagac
ggtgatctgggaatgattcggccatctcttcaattttcaagtgaaattacgaagaataaa
aagtggaaaacggaaagattcgtctacatcttcgaccaaatgatagtgctctgcaaacga
caccggaatacactaaaattcaaagatcgcctagccgttcattcgatcgacgtctttgat
attccagattccgaagtcacaaattgctttaaaatcgaatcacacgacaaatcaagcctc
cccaaaatctatcattttgtgtgtaaaaatcccgaagaaaaacgccaatggatggctgtt
ctggtgaaagtgacgacgaaaagcgtgctcgacagaattctagacaatcacgaaaaggaa
gaggcaaagaggatcccacttgtcgtgccaggacccgatcagtatcgattttcagagcca
gatacagaggataacatttctttcgaggattacacgtcgagcagtggtatccctgtgata
aagtgtggaactgttctgaagctgattgaacgactgacatatcattcttatacggatagc
aagtatattctgacatttctcatctcatatcggtcattttgtactccgaatgatttgttt
agtcttcttctcgaacgatttaatattccaactcctaagaagcttcaacaaccgaaacaa
ggtggcggtccactagctggtcgttatgatactgtccaatctcatggactatccgcaatt
tctagttcatcatgtatcaatccactctgcgagcagaaattccgaaaagagttccaacaa
ccgattcagctccgagttttgagtgtcatcaatcaatgggtcaaacttcattggtacgat
ttccagtgtgatcctgtacttctagatgctcttgaactatttctgaatagatgttgtgat
ccgagggaagggctcagtaaacagcataagaagttttgcaagacgatattggcgttgatt
gagaaacgagtcaagaatccgccgggaatcatgcaacagccgaatgagaatggggataag
ggagccgctgatgagggtcatgttaatagtgcatttgtgtttggtgatgatcaacaacat
ccgccacaacatcaagtgtatactaatgagagtcccaaggagaccaatcaggttctctgg
cacactgctcaaaaaggagacgtcgatcattacgatctgctcacactgcatccaatcgaa
attggaagacagttaactctgcttcactccgacttgtaccgagctattcagccgattgag
ctcgtcgaagccgcgtggacgaaagctgagaaatggaggaaaagtccgcagttgttgaga
ttaaccgatcattctacactgttaacctactgggtatcccgatcaatagtggaaacggaa
tccctcgaagaacgtatggcaatgttcaacagagtacttgaagtgatgtcagtattcgaa
gaacttcataatttcacgggtctagtcgccttctactctgcactcaattcttcgtgtatt
ttccgattaaaatggtgttgggatgggttggataacgagaagaagaagtgtttcgatcga
ttcaatacactttgtgaacggcgttggcaagaaatgcagaaacgtctcagttcgattaat
cccccgtgtattccgttcttcggtcattatctttccaatatttattttttggagcaaggt
aacagcacatttgtcaacaagtcaccaccacatggtgctgccggtgcacaaaaacagcag
aaggacgatttgaaggcatcggatcccgagaattcaaacaagcaattcaagcaactggta
tcatttctgaagttgcggaaaatttcgaatgtgatccgtgagatccagatcttccaggat
caacggtactcgctgacgttggagccgacgattcgacaattcttcgagtcaataaaccca
aagaatgatttcaaaagcaatgaggatttggaagaatacctctacaacaagtcactcgag
attcaaccaaaaggcctcgacacgccaacggcagaattgaagccaaagcacaatgcctca
acactccgttctcctggagtaaaaccgccgaaagctgcaggaaatcactactcggcgaat
catccgatcggacttcatcttcattctcagaattcgcattcggcaccacacgcaatgtca
agccagtcgagtacggtgccaaatactccactcagcgcacatgagacgaagagaagcttg
tcacataatcaggacgatgctcctctccaacaatttgtcgatattcgatttgagagaaag
gggacgcatccgaaaattcctgtcctccaaccgccaccacttcttccacgttcatcacga
gccaatcaaagtaattcggtctcactgccacctactacacaagctccaatgccaccagct
ccgaagagttctggaatgatgagcactgcgacgagtccgacgacactgacgacgacgacg
actcctagctctgcaggtggaccaccaccgaagcttcatccaagacgtatgacacagcag
ccgatgtctccgttggcaaagtctccgttgactccttctagagacaactcatcaccatcg
gccttccaatttcccgttgtctacgaagcatcaacagcaccaccacttccacctcgtcca
tctacatcgtcagatgtgtcgtcatctcccagcacatctggatccacatcgtcagctacc
aaagaaaatcaagaacagctccgagtaatcttcgatcgcgaagaatcacattctccaacc
gtccgtctttctgtgccccttccaccagctcttcctccaccgagaggatcttccgtgttc
cgggcgccaccaccacttccaccaaaatcaaaccgtcacaacagcaacagtccaacactt
tcttcggagcaacctttcgaagatccaatgtctccatcgattttcgtcaacactccacca
ccgccgttgccaccaaagacttacagaagctctaataagtag

DBGET integrated database retrieval system