KEGG   Caenorhabditis elegans (nematode): CELE_T28F12.3Help
Entry
CELE_T28F12.3     CDS       T00019                                 

Gene name
sos-1
Definition
Protein SOS-1
Orthology
K03099  
son of sevenless
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CELE_T28F12.3 (sos-1)
   04012 ErbB signaling pathway
    CELE_T28F12.3 (sos-1)
   04630 Jak-STAT signaling pathway
    CELE_T28F12.3 (sos-1)
   04068 FoxO signaling pathway
    CELE_T28F12.3 (sos-1)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    CELE_T28F12.3 (sos-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(4517668..4517797,4518417..4518530,4518585..4518759,4519894..4520157,4521746..4522025,4522455..4522577,4536178..4536312,4537148..4537567,4539144..4539272,4539321..4539401,4540652..4541705,4542408..4542486,4542541..4542790,4543514..4543912,4545851..4546102,4547556..4547858,4548810..4548896,4549007..4549093,4549146..4549265))
Genome map
AA seq 1493 aa AA seqDB search
MSIMSISLHSASSDTVSLTSRRTISTSKHWAAIFDERIYQICNIVHPGLPIDNAAVEHIR
YFLQSIVFELIEARATSVVEVDKTAKKLFAFGLQTVCKEAWDNMHQQLQKHKYQKALKTV
LESQHRLAAVIKETLGPREKEKKDREKKEIERIACYIYYACESVTEDVLRLTGNYVKNIR
NSEQKITMANLDVAMNGDKALMELRTKLRNEEEAESPGGFGFLSEFEEFVAEETEEKTLS
NSQTYESVAVDFLRDERRFIRELNRINVFRRRIESVAATDVDKQIVCNLFGNLTEIHDLA
LKIERTLEDAIELSDTQCIGMGIWEHGEAYEFDTYTFYIRRDGGEMNETRHATYVINDNI
KALLESERFASLFQSGEHYLGSSLDGQSFRLAVQYVLPQLLHIPIFHIYQYHEYITRLHQ
LSSSEEDRRDLNDCRSAFERVVGCVSDMSPELKTKITQFLDQQAKSEKIYNVKRLNEIQS
SIDGFTGSPIGKTCNELEKDGDLGMIRPSLQFSSEITKNKKWKTERFVYIFDQMIVLCKR
HRNTLKFKDRLAVHSIDVFDIPDSEVTNCFKIESHDKSSLPKIYHFVCKNPEEKRQWMAV
LVKVTTKSVLDRILDNHEKEEAKRIPLVVPGPDQYRFSEPDTEDNISFEDYTSSSGIPVI
KCGTVLKLIERLTYHSYTDSKYILTFLISYRSFCTPNDLFSLLLERFNIPTPKKLQQPKQ
GGGPLAGRYDTVQSHGLSAISSSSCINPLCEQKFRKEFQQPIQLRVLSVINQWVKLHWYD
FQCDPVLLDALELFLNRCCDPREGLSKQHKKFCKTILALIEKRVKNPPGIMQQPNENGDK
GAADEGHVNSAFVFGDDQQHPPQHQVYTNESPKETNQVLWHTAQKGDVDHYDLLTLHPIE
IGRQLTLLHSDLYRAIQPIELVEAAWTKAEKWRKSPQLLRLTDHSTLLTYWVSRSIVETE
SLEERMAMFNRVLEVMSVFEELHNFTGLVAFYSALNSSCIFRLKWCWDGLDNEKKKCFDR
FNTLCERRWQEMQKRLSSINPPCIPFFGHYLSNIYFLEQGNSTFVNKSPPHGAAGAQKQQ
KDDLKASDPENSNKQFKQLVSFLKLRKISNVIREIQIFQDQRYSLTLEPTIRQFFESINP
KNDFKSNEDLEEYLYNKSLEIQPKGLDTPTAELKPKHNASTLRSPGVKPPKAAGNHYSAN
HPIGLHLHSQNSHSAPHAMSSQSSTVPNTPLSAHETKRSLSHNQDDAPLQQFVDIRFERK
GTHPKIPVLQPPPLLPRSSRANQSNSVSLPPTTQAPMPPAPKSSGMMSTATSPTTLTTTT
TPSSAGGPPPKLHPRRMTQQPMSPLAKSPLTPSRDNSSPSAFQFPVVYEASTAPPLPPRP
STSSDVSSSPSTSGSTSSATKENQEQLRVIFDREESHSPTVRLSVPLPPALPPPRGSSVF
RAPPPLPPKSNRHNSNSPTLSSEQPFEDPMSPSIFVNTPPPPLPPKTYRSSNK
NT seq 4482 nt NT seq  +upstreamnt  +downstreamnt
atgagcataatgagcatatcactgcactcggcatcatcggatacggtctcgttgaccagc
cgacgaacaatatcaactagtaagcattgggcggctatttttgatgaaagaatttatcag
atatgcaatatcgtacatcctggcctcccgattgacaatgctgcagttgagcacattcga
tattttttgcaaagtatcgtttttgagctcatcgaagcacgtgccacaagtgtcgtcgaa
gtggacaaaactgcgaaaaagctgttcgcattcggtctgcagactgtttgtaaagaagcc
tgggacaacatgcaccaacaactccaaaagcacaaatatcaaaaagccctgaaaacagtt
ctagaaagccaacatcgcctggcagcagtcatcaaagaaacacttggaccacgagaaaaa
gagaaaaaagatcgagaaaagaaggaaatcgaacgtatcgcatgctatatttattatgca
tgtgaaagtgttactgaagatgtgctcaggctgactggaaattatgtgaaaaatattcga
aatagtgagcaaaagattacgatggctaatcttgatgtggcgatgaacggggataaggcc
ctaatggagctccgaacaaaacttcgaaacgaggaggaagccgaatctcccggcggtttt
ggttttctatcggaatttgaggaatttgttgccgaagagactgaagaaaagaccctatcg
aatagtcagacatatgaatcagtagctgttgattttttgagagatgagagacgatttatt
cgtgaattgaataggattaatgtatttcgacggagaatcgaatcggttgcggcgacggat
gttgataagcaaatcgtgtgcaacctgttcggaaatctcactgagatccacgatcttgct
ctgaaaatcgaacgaaccctcgaagatgccatcgagctcagcgatactcaatgtattgga
atgggaatttgggagcacggagaagcttatgaattcgatacctatacattctatataaga
agagatggtggagaaatgaatgagacacgacacgcgacatatgtgattaatgataatatt
aaagcattgctggaaagtgaacgattcgcctcgttattccaatcgggagaacattatttg
ggaagctcgttggatggacaaagttttcgattagctgtacaatatgtgttgcctcagttg
ttgcatattcccatttttcatatttatcagtatcatgagtatattactcgcctccaccaa
ctcagttccagtgaagaagatcgtcgtgatctgaatgattgtcgttcagcattcgaacgt
gtcgttggatgtgtatccgatatgtctcctgaattgaaaactaaaatcacacaatttctg
gatcagcaggcaaaaagtgaaaagatttataatgtgaaaagactgaatgaaattcaatcg
tcaattgatggatttaccggtagtccgattggaaaaacgtgcaatgaattggaaaaagac
ggtgatctgggaatgattcggccatctcttcaattttcaagtgaaattacgaagaataaa
aagtggaaaacggaaagattcgtctacatcttcgaccaaatgatagtgctctgcaaacga
caccggaatacactaaaattcaaagatcgcctagccgttcattcgatcgacgtctttgat
attccagattccgaagtcacaaattgctttaaaatcgaatcacacgacaaatcaagcctc
cccaaaatctatcattttgtgtgtaaaaatcccgaagaaaaacgccaatggatggctgtt
ctggtgaaagtgacgacgaaaagcgtgctcgacagaattctagacaatcacgaaaaggaa
gaggcaaagaggatcccacttgtcgtgccaggacccgatcagtatcgattttcagagcca
gatacagaggataacatttctttcgaggattacacgtcgagcagtggtatccctgtgata
aagtgtggaactgttctgaagctgattgaacgactgacatatcattcttatacggatagc
aagtatattctgacatttctcatctcatatcggtcattttgtactccgaatgatttgttt
agtcttcttctcgaacgatttaatattccaactcctaagaagcttcaacaaccgaaacaa
ggtggcggtccactagctggtcgttatgatactgtccaatctcatggactatccgcaatt
tctagttcatcatgtatcaatccactctgcgagcagaaattccgaaaagagttccaacaa
ccgattcagctccgagttttgagtgtcatcaatcaatgggtcaaacttcattggtacgat
ttccagtgtgatcctgtacttctagatgctcttgaactatttctgaatagatgttgtgat
ccgagggaagggctcagtaaacagcataagaagttttgcaagacgatattggcgttgatt
gagaaacgagtcaagaatccgccgggaatcatgcaacagccgaatgagaatggggataag
ggagccgctgatgagggtcatgttaatagtgcatttgtgtttggtgatgatcaacaacat
ccgccacaacatcaagtgtatactaatgagagtcccaaggagaccaatcaggttctctgg
cacactgctcaaaaaggagacgtcgatcattacgatctgctcacactgcatccaatcgaa
attggaagacagttaactctgcttcactccgacttgtaccgagctattcagccgattgag
ctcgtcgaagccgcgtggacgaaagctgagaaatggaggaaaagtccgcagttgttgaga
ttaaccgatcattctacactgttaacctactgggtatcccgatcaatagtggaaacggaa
tccctcgaagaacgtatggcaatgttcaacagagtacttgaagtgatgtcagtattcgaa
gaacttcataatttcacgggtctagtcgccttctactctgcactcaattcttcgtgtatt
ttccgattaaaatggtgttgggatgggttggataacgagaagaagaagtgtttcgatcga
ttcaatacactttgtgaacggcgttggcaagaaatgcagaaacgtctcagttcgattaat
cccccgtgtattccgttcttcggtcattatctttccaatatttattttttggagcaaggt
aacagcacatttgtcaacaagtcaccaccacatggtgctgccggtgcacaaaaacagcag
aaggacgatttgaaggcatcggatcccgagaattcaaacaagcaattcaagcaactggta
tcatttctgaagttgcggaaaatttcgaatgtgatccgtgagatccagatcttccaggat
caacggtactcgctgacgttggagccgacgattcgacaattcttcgagtcaataaaccca
aagaatgatttcaaaagcaatgaggatttggaagaatacctctacaacaagtcactcgag
attcaaccaaaaggcctcgacacgccaacggcagaattgaagccaaagcacaatgcctca
acactccgttctcctggagtaaaaccgccgaaagctgcaggaaatcactactcggcgaat
catccgatcggacttcatcttcattctcagaattcgcattcggcaccacacgcaatgtca
agccagtcgagtacggtgccaaatactccactcagcgcacatgagacgaagagaagcttg
tcacataatcaggacgatgctcctctccaacaatttgtcgatattcgatttgagagaaag
gggacgcatccgaaaattcctgtcctccaaccgccaccacttcttccacgttcatcacga
gccaatcaaagtaattcggtctcactgccacctactacacaagctccaatgccaccagct
ccgaagagttctggaatgatgagcactgcgacgagtccgacgacactgacgacgacgacg
actcctagctctgcaggtggaccaccaccgaagcttcatccaagacgtatgacacagcag
ccgatgtctccgttggcaaagtctccgttgactccttctagagacaactcatcaccatcg
gccttccaatttcccgttgtctacgaagcatcaacagcaccaccacttccacctcgtcca
tctacatcgtcagatgtgtcgtcatctcccagcacatctggatccacatcgtcagctacc
aaagaaaatcaagaacagctccgagtaatcttcgatcgcgaagaatcacattctccaacc
gtccgtctttctgtgccccttccaccagctcttcctccaccgagaggatcttccgtgttc
cgggcgccaccaccacttccaccaaaatcaaaccgtcacaacagcaacagtccaacactt
tcttcggagcaacctttcgaagatccaatgtctccatcgattttcgtcaacactccacca
ccgccgttgccaccaaagacttacagaagctctaataagtag

DBGET integrated database retrieval system