KEGG   Caenorhabditis elegans (nematode): CELE_VC5.4Help
Entry
CELE_VC5.4        CDS       T00019                                 

Gene name
mys-1
Definition
Protein MYS-1
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(7081740..7081757,7082655..7083350,7083865..7084210,7084274..7084451,7084497..7084635))
Genome map
AA seq 458 aa AA seqDB search
MTEPKKEIIEDENHGISKKIPTDPRQYEKVTEGCRLLVMMASQEEERWAEVISRCRAANG
SIKFYVHYIDCNRRLDEWVQSDRLNLASCELPKKGGKKGAHLREENRDSNENEGKKSGRK
RKIPLLPMDDLKAESVDPLQAISTMTSGSTPSLRGSMSMVGHSEDAMTRIRNVECIELGR
SRIQPWYFAPYPQQLTSLDCIYICEFCLKYLKSKTCLKRHMEKCAMCHPPGNQIYSHDKL
SFFEIDGRKNKSYAQNLCLLAKLFLDHKTLYYDTDPFLFYVLTEEDEKGHHIVGYFSKEK
ESAEEYNVACILVLPPFQKKGYGSLLIEFSYELSKIEQKTGSPEKPLSDLGLLSYRSYWS
MAIMKELFAFKRRHPGEDITVQDISQSTSIKREDVVSTLQQLDLYKYYKGSYIIVISDEK
RQVYEKRIEAAKKKTRINPAALQWRPKEYGKKRAQIMF
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagccgaagaaggagattatagaggacgaaaatcatggaatatccaagaaaata
ccaacagatcccaggcaatacgagaaagttacagagggatgccggttattggtcatgatg
gcttcacaagaagaagaaagatgggccgaagttatttcaagatgccgagctgcaaatggt
tcaattaaattctatgtccattatatcgattgcaaccgaagacttgacgaatgggttcag
tctgataggctcaatttagcgtcgtgtgagctaccaaaaaaaggaggaaagaaaggagca
cacttgcgggaagaaaatcgagattcgaatgaaaatgaaggaaagaaaagcggccgaaaa
cgaaagattccactacttccgatggatgatctcaaggcggaatccgtagatccattacaa
gcaatttcaacgatgaccagcggatctactccaagtcttcgaggttccatgtcgatggtc
ggccatagtgaagatgcaatgacaaggatccgaaatgtcgaatgcattgaactaggaaga
tcacgaattcagccatggtactttgcaccttatccacaacaattgacaagtttggattgt
atttatatttgcgaattttgtctgaaatatctaaagtcgaaaacttgtctgaaacggcac
atggaaaaatgtgcaatgtgtcacccacctggcaatcaaatctacagtcacgataaactt
tcattttttgaaatcgacggccgcaaaaacaaaagctatgctcagaatctatgcctgctt
gccaaactttttctggatcacaagactctttactatgacacggatccatttttgttctat
gtgctaaccgaagaagacgagaagggtcatcatatagttggatacttttcaaaagaaaaa
gaatcagctgaagaatataatgttgcgtgtattcttgtgttacctccatttcaaaagaaa
ggatacggaagtttgctcatcgaattcagctatgaactctcgaaaattgaacagaagaca
ggatcacccgaaaaaccactatcagatttgggacttctctcatatcgatcgtactggtca
atggccatcatgaaagagcttttcgcattcaaaagacgacatccaggcgaagatatcaca
gttcaggacatttcacaaagtacatcgattaaacgagaagatgttgtgtcaacgttacag
caacttgatctatacaaatactataagggatcatacataattgtgattagtgatgaaaag
cgtcaagtttatgagaaacggattgaggctgcgaaaaagaagacacgaattaatccagca
gctctgcaatggcgacccaaagagtacggaaagaaaagagcgcagatcatgttctag

DBGET integrated database retrieval system