KEGG   Caenorhabditis elegans (nematode): CELE_VZK822L.1Help
Entry
CELE_VZK822L.1    CDS       T00019                                 

Gene name
fat-6
Definition
Protein FAT-6, isoform C
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CELE_VZK822L.1 (fat-6)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CELE_VZK822L.1 (fat-6)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CELE_VZK822L.1 (fat-6)
Lipid biosynthesis proteins [BR:cel01004]
 Desaturase
  First
   CELE_VZK822L.1 (fat-6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:complement(join(11913819..11914098,11914207..11914368,11914424..11914671))
Genome map
AA seq 229 aa AA seqDB search
MRIFLMILNNIALQNDVIEWARDHRCHHKWTDTDADPHNTTRGFFFAHMGWLLVRKHPQV
KEQGAKLDMSDLLSDPVLVFQRKHYFPLVILCCFILPTIIPVYFWKETAFIAFYTAGTFR
YCFTLHATWCINSAAHYFGWKPYDSSITPVENVFTTIAAVGEGGHNFHHTFPQDYRTSEY
SLKYNWTRVLIDTAAALGLVYDRKTACDEIIGRQVSNHGCDIQRGKSIM
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcttcttgatgatcttgaacaatattgctcttcaaaatgacgtcatcgaatgg
gctcgtgatcatcgttgccatcacaagtggactgataccgatgctgatccacataacacc
actcgtggattcttcttcgctcatatgggatggcttcttgtgcgtaagcatccacaagtt
aaggaacaaggagccaagcttgacatgtctgatctcttgagtgacccagttctcgtcttc
cagagaaaacattacttcccacttgtcatcttgtgctgcttcattcttccaacaattatc
ccagtttacttctggaaggagactgcattcattgccttctacacagctggaacattccgt
tattgcttcacacttcatgctacatggtgcatcaacagcgctgctcactatttcggatgg
aagccatacgattcctcaattaccccagtcgaaaacgtcttcaccacaattgctgccgtc
ggagagggaggtcacaacttccatcacacattcccacaagactacagaacatctgaatac
tcattgaaatacaattggacacgtgtccttattgatactgcagctgctcttggacttgtc
tacgaccggaaaactgcttgtgatgagattatcggccggcaggtatccaatcatggatgt
gatattcaacgaggaaaatcaatcatgtaa

DBGET integrated database retrieval system