KEGG   Caenorhabditis elegans (nematode): CELE_W02F12.5Help
Entry
CELE_W02F12.5     CDS       T00019                                 

Gene name
dlst-1
Definition
Protein DLST-1
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CELE_W02F12.5 (dlst-1)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CELE_W02F12.5 (dlst-1)
  Amino acid metabolism
   00310 Lysine degradation
    CELE_W02F12.5 (dlst-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CELE_W02F12.5 (dlst-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(6707295..6707429,6707574..6708024,6708075..6708445,6708503..6708759,6708811..6708891,6708939..6708978,6709034..6709090))
Genome map
AA seq 463 aa AA seqDB search
MLGRRAVSVHRFLSRAARQSVTAASSAQPSLQAKTSLLEPLVQNVRITSSANFHMSAVRM
SDVITVEGPAFAESISEGDIRWLKQKGDHVNEDELVAEIETDKTSVEVPAPQAGTIVEFL
VEDGAKVTAKQKLYKLQPGAGGGSSSAPAKEEPKSAPAKEESKPAPAKEDSKPAVTAAAP
PKPVSGDIPKSAPPVARPPSTPSSSTPVGAVPVTRVVVPKGVDPSHAITGARDEVRVKAN
RMRMRIAQRLKDAQNTYAMLTTFNEIDMSSLIEMRKTYQKDFVAKHGVKLGMMSPFVRAA
AYALQESPVVNAVLDENEIVYRHFVDISVAVATPKGLVVPVLRNVESMNYAQIELELANL
GVKARDGKLAVEDMEGGTFTISNGGVFGSMFGTPIINPPQSAILGMHGVFDRVVPVNGKP
EIRPIMQIALTYDHRLIDGREAVTFLKKIKTAVEDPRIMFMNL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgctcgggcgacgtgcagtatcagttcatcggtttctttccagagccgcgagacaaagc
gtaactgctgcctcttctgcacagccaagcctccaagctaagaccagtttgttggaacca
ctcgttcaaaatgtgagaattacatcttcagccaacttccacatgagtgcagtaagaatg
agcgatgttattaccgtcgaaggaccagcttttgctgaatcaatttcggaaggagatatt
agatggctaaagcagaagggagatcatgttaacgaagacgaacttgtcgctgagattgag
acggataaaacttcggttgaagtaccagctccacaagccggaacaattgtcgagtttctc
gtggaagatggagctaaagtgacagccaagcaaaagctttataaacttcagccaggagca
ggcggaggctcgtcttcagcgccagctaaagaagaaccaaaatcagcgccagccaaagaa
gaatcaaaaccagctccagccaaggaagattcgaagccagctgtgactgccgctgcccca
ccaaagccagtttctggggatattccaaaatctgctccaccagttgctcgcccaccatca
acaccatcatcttccactccagtcggagccgtcccagtcactcgtgtcgttgttccaaag
ggagttgatccatcccacgcaatcaccggagcccgtgatgaagtccgcgttaaagccaac
agaatgcgcatgcgcattgctcaaagactgaaggatgctcagaatacttatgctatgctt
actaccttcaatgagattgatatgagcagcctcatcgaaatgagaaagacttatcagaag
gattttgttgccaagcacggagttaagctcggaatgatgtctccatttgtccgcgctgcc
gcctacgctcttcaagaatctccagttgttaacgccgttctcgatgaaaacgaaattgtc
taccgtcactttgtcgatatctccgttgctgttgctacaccgaaaggactcgttgttcca
gtcttgagaaatgtcgagagcatgaattatgctcaaatcgaattggaacttgccaatctc
ggagtgaaggctcgtgacggaaagctggctgttgaagatatggagggaggaaccttcacg
atttctaacggtggagtcttcggatccatgttcggaaccccaatcatcaatccaccacaa
agtgcaattttgggaatgcacggagtgtttgatcgtgttgttccagtcaacggaaagcca
gagatccgaccaatcatgcaaatcgctttgacctacgaccacagattgatcgatggaaga
gaggcagtcaccttcctcaagaagatcaagaccgccgtcgaggatccacgaatcatgttc
atgaatctttaa

DBGET integrated database retrieval system