KEGG   Caenorhabditis elegans (nematode): CELE_W02F12.5Help
Entry
CELE_W02F12.5     CDS       T00019                                 

Gene name
dlst-1
Definition
Protein DLST-1
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CELE_W02F12.5 (dlst-1)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CELE_W02F12.5 (dlst-1)
  Amino acid metabolism
   00310 Lysine degradation
    CELE_W02F12.5 (dlst-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CELE_W02F12.5 (dlst-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(6707295..6707429,6707574..6708024,6708075..6708445,6708503..6708759,6708811..6708891,6708939..6708978,6709034..6709090))
Genome map
AA seq 463 aa AA seqDB search
MLGRRAVSVHRFLSRAARQSVTAASSAQPSLQAKTSLLEPLVQNVRITSSANFHMSAVRM
SDVITVEGPAFAESISEGDIRWLKQKGDHVNEDELVAEIETDKTSVEVPAPQAGTIVEFL
VEDGAKVTAKQKLYKLQPGAGGGSSSAPAKEEPKSAPAKEESKPAPAKEDSKPAVTAAAP
PKPVSGDIPKSAPPVARPPSTPSSSTPVGAVPVTRVVVPKGVDPSHAITGARDEVRVKAN
RMRMRIAQRLKDAQNTYAMLTTFNEIDMSSLIEMRKTYQKDFVAKHGVKLGMMSPFVRAA
AYALQESPVVNAVLDENEIVYRHFVDISVAVATPKGLVVPVLRNVESMNYAQIELELANL
GVKARDGKLAVEDMEGGTFTISNGGVFGSMFGTPIINPPQSAILGMHGVFDRVVPVNGKP
EIRPIMQIALTYDHRLIDGREAVTFLKKIKTAVEDPRIMFMNL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgctcgggcgacgtgcagtatcagttcatcggtttctttccagagccgcgagacaaagc
gtaactgctgcctcttctgcacagccaagcctccaagctaagaccagtttgttggaacca
ctcgttcaaaatgtgagaattacatcttcagccaacttccacatgagtgcagtaagaatg
agcgatgttattaccgtcgaaggaccagcttttgctgaatcaatttcggaaggagatatt
agatggctaaagcagaagggagatcatgttaacgaagacgaacttgtcgctgagattgag
acggataaaacttcggttgaagtaccagctccacaagccggaacaattgtcgagtttctc
gtggaagatggagctaaagtgacagccaagcaaaagctttataaacttcagccaggagca
ggcggaggctcgtcttcagcgccagctaaagaagaaccaaaatcagcgccagccaaagaa
gaatcaaaaccagctccagccaaggaagattcgaagccagctgtgactgccgctgcccca
ccaaagccagtttctggggatattccaaaatctgctccaccagttgctcgcccaccatca
acaccatcatcttccactccagtcggagccgtcccagtcactcgtgtcgttgttccaaag
ggagttgatccatcccacgcaatcaccggagcccgtgatgaagtccgcgttaaagccaac
agaatgcgcatgcgcattgctcaaagactgaaggatgctcagaatacttatgctatgctt
actaccttcaatgagattgatatgagcagcctcatcgaaatgagaaagacttatcagaag
gattttgttgccaagcacggagttaagctcggaatgatgtctccatttgtccgcgctgcc
gcctacgctcttcaagaatctccagttgttaacgccgttctcgatgaaaacgaaattgtc
taccgtcactttgtcgatatctccgttgctgttgctacaccgaaaggactcgttgttcca
gtcttgagaaatgtcgagagcatgaattatgctcaaatcgaattggaacttgccaatctc
ggagtgaaggctcgtgacggaaagctggctgttgaagatatggagggaggaaccttcacg
atttctaacggtggagtcttcggatccatgttcggaaccccaatcatcaatccaccacaa
agtgcaattttgggaatgcacggagtgtttgatcgtgttgttccagtcaacggaaagcca
gagatccgaccaatcatgcaaatcgctttgacctacgaccacagattgatcgatggaaga
gaggcagtcaccttcctcaagaagatcaagaccgccgtcgaggatccacgaatcatgttc
atgaatctttaa

DBGET integrated database retrieval system