KEGG   Caenorhabditis elegans (nematode): CELE_W06D12.3Help
Entry
CELE_W06D12.3     CDS       T00019                                 

Gene name
fat-5
Definition
Protein FAT-5
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cel01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:cel01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(17724979..17725192,17725248..17725584,17726241..17726691)
Genome map
AA seq 333 aa AA seqDB search
MTQIKVDAIISKQFLAADLNEIRQMQEESKKQVIKMEIVWKNVALFVALHIGALVGLYQL
VFQAKWATVGWVFLLHTLGSMGVTGGAHRLWAHRAYKATLSWRVFLMLINSIAFQNDIID
WARDHRCHHKWTDTDADPHSTNRGMFFAHMGWLLVKKHDQLKIQGGKLDLSDLYEDPVLM
FQRKNYLPLVGIFCFALPTFIPVVLWGESAFIAFYTAALFRYCFTLHATWCINSVSHWVG
WQPYDHQASSVDNLWTSIAAVGEGGHNYHHTFPQDYRTSEHAEFLNWTRVLIDFGASIGM
VYDRKTTPEEVIQRQCKKFGCETEREKMLHKLG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaatcaaagtagatgcgattatatctaaacagttcctggcggcggacctgaac
gagatccgacaaatgcaggaagagagcaagaagcaggtgatcaaaatggaaattgtctgg
aagaatgtcgctttatttgtggctctacacattggagccctggtcggactatatcagctt
gtgttccaggccaagtgggctacagttggatgggtattcctcctgcacaccctgggaagc
atgggtgtcaccggcggagcccatcgtctctgggcccaccgagcctacaaagccaccctc
tcatggagagtattcctgatgctcatcaactcgatcgctttccaaaatgacattatcgac
tgggccagagatcaccggtgccatcacaagtggacggatactgatgctgacccgcatagc
accaaccgcggaatgttcttcgctcatatgggatggttgttggtgaagaagcacgatcag
ttgaagattcagggaggaaagttggatttaagcgatttgtacgaggatccggtgctgatg
ttccagaggaagaactacctccccttggtcggaatcttctgcttcgccctgcccaccttc
attccagtcgtcctctggggcgagtcagccttcatcgccttctacacggccgccctcttc
cgttactgcttcaccctccacgctacatggtgcatcaacagtgtctcccactgggtcgga
tggcagccatacgatcatcaagcctcatcagtagacaatctatggacatctattgcggca
gtcggagaaggaggtcacaactaccatcacaccttcccccaggactatagaacttccgag
cacgcggagttcttgaactggacccgagtattgattgatttcggggcgtctattggaatg
gtgtatgatcggaagactactccggaagaggtaatacaaagacagtgcaagaagttcggc
tgtgaaactgaacgggagaaaatgctccacaaattgggataa

DBGET integrated database retrieval system