KEGG   Caenorhabditis elegans (nematode): CELE_W06F12.1Help
Entry
CELE_W06F12.1     CDS       T00019                                 

Gene name
lit-1
Definition
Protein LIT-1, isoform D
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CELE_W06F12.1 (lit-1)
   04310 Wnt signaling pathway
    CELE_W06F12.1 (lit-1)
   04068 FoxO signaling pathway
    CELE_W06F12.1 (lit-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CELE_W06F12.1 (lit-1)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CELE_W06F12.1 (lit-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(13702192..13702246,13714572..13714676,13715498..13715671,13715750..13715851,13718354..13718466,13719826..13719941,13720097..13720282,13721690..13721796,13722263..13722897,13723251..13723463)
Genome map
AA seq 601 aa AA seqDB search
MGRNQEGQFNGAGNSESAGSSSSSGCSSSSTELYDLAAAHAALISRQQQILSQAIPIIPE
HQLAAVAAHHQHHQQLHPSVQYQLVAAATHHNHHQPQAAQPHYSAVVPRSDVIQQPPHFA
LHHHLQNLVQQQQQQQAHHHHQQLVGEMALVSHTHPAAVGSTTCYEKNQQKQQQVQQIPT
QPQVAHVSSNAILAAAQPFYPPPVQDSQPDRPIGYGAFGVVWSVTDPRSGKRVALKKMPN
VFQNLASCKRVFREIKMLSSFRHDNVLSLLDILQPANPSFFQELYVLTELMQSDLHKIIV
SPQALTPDHVKVFVYQILRGLKYLHTANILHRDIKPGNLLVNSNCILKICDFGLARTWDQ
RDRLNMTHEVVTQYYRAPELLMGARRYTGAVDIWSVGCIFAELLQRKILFQAAGPIEQLQ
MIIDLLGTPSQEAMKYACEGAKNHVLRAGLRAPDTQRLYKIASPDDKNHEAVDLLQKLLH
FDPDKRISVEEALQHRYLEEGRLRFHSCMCSCCYTKPNMPSRLFAQDLDPRHESPFDPKW
EKDMSRLSMFELREKMYQFVMDRPALYGVALCINPQSAAYKNFASSSVAQASELPPSPQA
W
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgggaagaaatcaagagggacagtttaacggagctggaaactccgaatcagcaggatca
agcagttcatccggctgtagttcgtcatctacagagctctacgatcttgcagctgcacac
gccgcacttatatcccgacagcaacagattctcagtcaggcaatcccaataataccggaa
caccagctggccgccgtcgccgctcaccatcaacatcaccagcagcttcacccatcggta
cagtaccagctcgtcgctgccgccacccatcacaatcatcatcagccgcaagcggcacaa
ccacactattcagcagttgtgccacgatctgacgtaatacaacaaccaccacactttgct
ctgcaccaccatcttcagaatttggttcaacagcagcagcaacagcaggctcaccatcat
catcagcaattagttggtgaaatggccctagtttcacatacacatccggccgccgtcggc
tctacgacgtgctacgaaaaaaatcagcagaaacagcaacaagtacagcagattcccaca
caaccacaggtcgcccacgtgtcttcaaatgcgatcctcgctgccgcacaaccattctac
cctccaccagtacaagatagtcagccagacaggcctattggttatggtgcatttggagtt
gtatggtcagtaacagatccgcggagtggaaaacgagtagctctcaaaaaaatgcccaac
gtgttccagaatcttgcttcttgtaagcgagtgtttcgagaaatcaaaatgctcagctca
ttccgacatgacaacgttctctcgctgctagacattctgcaacccgcgaatccgagcttt
tttcaagaattatatgtgctcacggagttgatgcagagcgacctacacaagattatcgtt
tccccgcaagctttgacacccgaccatgtcaaagtttttgtttatcagattctcagagga
ctaaaatatttgcacactgcaaacatcctgcatcgagacatcaaaccgggaaatctctta
gtcaacagcaattgcattttaaaaatttgcgattttggactcgctcgaacctgggaccaa
cgtgaccggctcaacatgacacacgaggttgtgacccagtactatagagccccggagttg
ttaatgggcgcgcgaaggtatacgggagccgtggatatttggtccgtcggttgcatattt
gccgagctgctacaaaggaaaattctatttcaagccgccggtccgattgagcagctgcaa
atgattatcgatttattgggaaccccatcgcaagaggctatgaaatacgcttgtgaggga
gccaagaaccatgtgctccgcgccggtcttcgagctcctgacacacagaggctgtacaag
atcgcatcgcctgatgataagaatcacgaggcggtggatttactgcagaagcttctgcac
ttcgatccggataagagaattagtgtggaggaggcactgcaacatcgatatttagaagaa
gggcgtctgcgattccactcgtgtatgtgctcgtgctgctatacgaaaccaaatatgccg
tcgaggttgttcgcgcaggatttggatccacgtcacgagagcccattcgatccaaagtgg
gagaaggacatgtcccgactatcgatgtttgagctccgcgagaaaatgtaccaatttgtg
atggacaggcctgcgttgtacggtgtcgccctttgcataaatccccaatcggcggcctac
aagaactttgcaagctcgtcagttgctcaggcctcagaattacctccatcaccgcaggct
tggtga

DBGET integrated database retrieval system