KEGG   Caenorhabditis elegans (nematode): CELE_W09B12.1Help
Entry
CELE_W09B12.1     CDS       T00019                                 

Gene name
ace-1
Definition
Protein ACE-1
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CELE_W09B12.1 (ace-1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     CELE_W09B12.1 (ace-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(16367381..16367419,16368238..16368374,16368422..16368706,16369063..16369309,16369602..16369780,16370099..16370572,16371993..16372157,16372203..16372393,16373075..16373174,16373227..16373272)
Genome map
AA seq 620 aa AA seqDB search
MRNSLLFFIFLPSTILAVDLIHLHDGSPLFGEEVLSQTGKPLTRFQGIPFAEPPVGNLRF
KKPKPKQPWRIPLNATTPPNSCIQSEDTYFGDFYGSTMWNANTKLSEDCLYLNVYVPGKV
DPNKKLAVMVWVYGGGFWSGTATLDVYDGRILTVEENVILVAMNYRVSIFGFLYMNRPEA
PGNMGMWDQLLAMKWVHKNIDLFGGDLSRITLFGESAGAASVSIHMLSPKSAPYFHRAII
QSGSATSPWAIEPRDVALARAVILYNAMKCGNMSLINPDYDRILDCFQRADADALRENEW
APVREFGDFPWVPVVDGDFLLENAQTSLKQGNFKKTQLLAGSNRDESIYFLTYQLPDIFP
VADFFTKTDFIKDRQLWIKGVKDLLPRQILKCQLTLAAVLHEYEPQDLPVTPRDWINAMD
KMLGDYHFTCSVNEMALAHTKHGGDTYYYYFTHRASQQTWPEWMGVLHGYEINFIFGEPL
NQKRFNYTDEERELSNRFMRYWANFAKTGDPNKNEDGSFTQDVWPKYNSVSMEYMNMTVE
SSYPSMKRIGHGPRRKECAFWKAYLPNLMAAVADVGDPYLVWKQQMDKWQNEYITDWQYH
FEQYKRYQTYRQSDSETCGG
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaattccttactattcttcatttttctgccttcgacgatattagctgttgatctc
attcacctccatgatggctccccactttttggcgaagaagttttatcacaaaccggtaaa
ccattgacaaggtttcaaggtattccatttgcagaaccaccagttggcaatctcaggttt
aaaaaaccgaaaccaaagcaaccatggagaatacctttgaatgcgacaactccaccgaac
agttgtattcagagtgaggacacttactttggagacttttatggttccactatgtggaat
gccaacactaaattatccgaagattgtctgtatttgaatgtgtatgtgcctggaaaagtg
gacccaaataagaaattggctgtaatggtttgggtttatggaggaggtttctggtctggc
acagcgacacttgatgtctatgacgggaggatacttactgttgaagaaaacgtgattctg
gttgcgatgaactatcgtgtatcaatattcggattcctctatatgaaccgtcccgaggca
ccaggaaacatgggaatgtgggatcagcttcttgcgatgaaatgggttcacaagaacatt
gacctgtttggcggagaccttagtcgcatcacattgttcggtgaatcagcaggcgcggcg
tcagtgagcattcacatgttgagtccgaaaagtgcaccttattttcatagagcaatcatc
caatctggctcggcaacatctccttgggccatcgaaccgcgtgacgtagcattagcgaga
gcagttattttatataatgccatgaaatgtggaaacatgtctcttatcaatccagactac
gatcgaatactggactgttttcaaagagctgacgcagatgctttacgggaaaacgagtgg
gctcctgttcgagaatttggcgattttccatgggttcccgttgtcgatggtgattttcta
ttggaaaatgcacaaacctcgttaaaacaaggaaacttcaaaaagacccaactcctggcc
ggaagtaatcgtgacgagagcatttatttcctgacctatcaacttccggatatattccca
gtcgctgacttttttacaaaaactgattttatcaaagatcggcaattgtggatcaagggt
gtcaaggacctgctaccacgtcagatactgaaatgtcagctcacactagcggcggttctt
catgaatacgaacctcaggatttaccagtgacaccaagagactggataaatgcaatggat
aaaatgctgggagactatcattttacttgtagcgttaatgaaatggctctggctcatacg
aaacacggaggagacacatactattactattttacacacagagcttctcaacaaacatgg
ccagaatggatgggtgttttacatggttacgaaatcaatttcatttttggagaaccatta
aatcaaaaaagattcaactacactgatgaagaacgagagttgagcaatcggtttatgaga
tattgggcgaattttgcaaaaactggagatccgaacaaaaacgaggatggatcatttact
caagacgtgtggccaaagtataattctgtttcaatggaatacatgaacatgaccgttgaa
tcgtcatatcccagcatgaaacgaatagggcatggtccgaggagaaaggagtgtgcattt
tggaaagcgtatttgccgaatttgatggctgcagttgccgacgtcggagacccttatttg
gtttggaagcaacaaatggataaatggcagaacgagtacattacagattggcaatatcat
ttcgagcagtataaaaggtatcaaacgtataggcaatctgatagcgaaacttgtggtgga
taa

DBGET integrated database retrieval system