KEGG   Caenorhabditis elegans (nematode): CELE_W09B12.1Help
Entry
CELE_W09B12.1     CDS       T00019                                 

Gene name
ace-1
Definition
Protein ACE-1
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cel00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(16367309..16367347,16368166..16368302,16368350..16368634,16368991..16369237,16369530..16369708,16370027..16370500,16371921..16372085,16372131..16372321,16373003..16373102,16373155..16373200)
Genome map
AA seq 620 aa AA seqDB search
MRNSLLFFIFLPSTILAVDLIHLHDGSPLFGEEVLSQTGKPLTRFQGIPFAEPPVGNLRF
KKPKPKQPWRIPLNATTPPNSCIQSEDTYFGDFYGSTMWNANTKLSEDCLYLNVYVPGKV
DPNKKLAVMVWVYGGGFWSGTATLDVYDGRILTVEENVILVAMNYRVSIFGFLYMNRPEA
PGNMGMWDQLLAMKWVHKNIDLFGGDLSRITLFGESAGAASVSIHMLSPKSAPYFHRAII
QSGSATSPWAIEPRDVALARAVILYNAMKCGNMSLINPDYDRILDCFQRADADALRENEW
APVREFGDFPWVPVVDGDFLLENAQTSLKQGNFKKTQLLAGSNRDESIYFLTYQLPDIFP
VADFFTKTDFIKDRQLWIKGVKDLLPRQILKCQLTLAAVLHEYEPQDLPVTPRDWINAMD
KMLGDYHFTCSVNEMALAHTKHGGDTYYYYFTHRASQQTWPEWMGVLHGYEINFIFGEPL
NQKRFNYTDEERELSNRFMRYWANFAKTGDPNKNEDGSFTQDVWPKYNSVSMEYMNMTVE
SSYPSMKRIGHGPRRKECAFWKAYLPNLMAAVADVGDPYLVWKQQMDKWQNEYITDWQYH
FEQYKRYQTYRQSDSETCGG
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaattccttactattcttcatttttctgccttcgacgatattagctgttgatctc
attcacctccatgatggctccccactttttggcgaagaagttttatcacaaaccggtaaa
ccattgacaaggtttcaaggtattccatttgcagaaccaccagttggcaatctcaggttt
aaaaaaccgaaaccaaagcaaccatggagaatacctttgaatgcgacaactccaccgaac
agttgtattcagagtgaggacacttactttggagacttttatggttccactatgtggaat
gccaacactaaattatccgaagattgtctgtatttgaatgtgtatgtgcctggaaaagtg
gacccaaataagaaattggctgtaatggtttgggtttatggaggaggtttctggtctggc
acagcgacacttgatgtctatgacgggaggatacttactgttgaagaaaacgtgattctg
gttgcgatgaactatcgtgtatcaatattcggattcctctatatgaaccgtcccgaggca
ccaggaaacatgggaatgtgggatcagcttcttgcgatgaaatgggttcacaagaacatt
gacctgtttggcggagaccttagtcgcatcacattgttcggtgaatcagcaggcgcggcg
tcagtgagcattcacatgttgagtccgaaaagtgcaccttattttcatagagcaatcatc
caatctggctcggcaacatctccttgggccatcgaaccgcgtgacgtagcattagcgaga
gcagttattttatataatgccatgaaatgtggaaacatgtctcttatcaatccagactac
gatcgaatactggactgttttcaaagagctgacgcagatgctttacgggaaaacgagtgg
gctcctgttcgagaatttggcgattttccatgggttcccgttgtcgatggtgattttcta
ttggaaaatgcacaaacctcgttaaaacaaggaaacttcaaaaagacccaactcctggcc
ggaagtaatcgtgacgagagcatttatttcctgacctatcaacttccggatatattccca
gtcgctgacttttttacaaaaactgattttatcaaagatcggcaattgtggatcaagggt
gtcaaggacctgctaccacgtcagatactgaaatgtcagctcacactagcggcggttctt
catgaatacgaacctcaggatttaccagtgacaccaagagactggataaatgcaatggat
aaaatgctgggagactatcattttacttgtagcgttaatgaaatggctctggctcatacg
aaacacggaggagacacatactattactattttacacacagagcttctcaacaaacatgg
ccagaatggatgggtgttttacatggttacgaaatcaatttcatttttggagaaccatta
aatcaaaaaagattcaactacactgatgaagaacgagagttgagcaatcggtttatgaga
tattgggcgaattttgcaaaaactggagatccgaacaaaaacgaggatggatcatttact
caagacgtgtggccaaagtataattctgtttcaatggaatacatgaacatgaccgttgaa
tcgtcatatcccagcatgaaacgaatagggcatggtccgaggagaaaggagtgtgcattt
tggaaagcgtatttgccgaatttgatggctgcagttgccgacgtcggagacccttatttg
gtttggaagcaacaaatggataaatggcagaacgagtacattacagattggcaatatcat
ttcgagcagtataaaaggtatcaaacgtataggcaatctgatagcgaaacttgtggtgga
taa

DBGET integrated database retrieval system