KEGG   Caenorhabditis elegans (nematode): CELE_Y105C5B.3Help
Entry
CELE_Y105C5B.3    CDS       T00019                                 

Gene name
Y105C5B.3
Definition
Protein Y105C5B.3
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CELE_Y105C5B.3 (Y105C5B.3)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CELE_Y105C5B.3 (Y105C5B.3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(15884222..15884354,15884897..15885058,15886150..15886424,15887297..15887800,15888237..15888415,15888719..15888782)
Genome map
AA seq 438 aa AA seqDB search
MILWFSLVFVLFFKASDGKAVEQVHLSLSGNPNEMVVTWLTQNPLPNVTLYALFGVSQDS
LRFTAKGNTTGWADQGKHKTMRYTHRATMQNLVPGQVYYYQVGSSQAMSSIFHFRQPDPS
QPLRAAIFGDLSIIKGQQSIDQLIEATKQNQLDVIIHIGDLAYDLHDENGATGDDYMNAI
EPFAAYVPYMVFAGNHEVDGDFNHIKNRFTMPRNGVYDNNLFWSFTYGFVHIIAINSEYY
AEEMSNEAKAQYQWLREDLAQNTKKWTIVMFHRPWYCSSKKKKGCNDDQDILSREGDKKK
FPGLEELLNQYKVDMVLYGHKHTYERMWPIYNKNPFKSANPGHIKNAPAPVYILTGGAGC
HSHEDPSDHIMQDFSVKALGEYGYTYLTVYNSTHISTDYVDTSSTTGKFLDPFVLEKLRF
LSGFLNVYFHNEKKCAAH
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgattctttggttttctctagtgtttgtgctctttttcaaagcttccgatggaaaagca
gtggagcaagtgcacctgagcctcagtggaaacccaaatgagatggtcgtgacgtggctg
acacagaatccgctaccaaatgtgactctatatgcattattcggcgtttcccaggattct
ctgagatttactgcaaaaggaaatacaactggatgggctgatcagggaaaacataaaaca
atgagatatacccatagggcaactatgcagaatttggtacccgggcaggtttattattat
caagtaggcagttcacaggcaatgtcctccattttccacttccgtcaacccgatccatct
caaccgctccgagctgcaatttttggagatttgagcattattaaaggccaacaatcaata
gatcaactaattgaagctacaaaacaaaatcaattggatgtaataattcatattggagac
ttggcatacgatttacatgatgaaaatggagcaactggagatgattatatgaatgcaatt
gagccatttgctgcatatgttccttatatggttttcgccggaaaccacgaagtcgacggg
gacttcaaccatatcaaaaaccgcttcacaatgcctagaaatggagtttacgacaacaat
cttttttggagtttcacctatggatttgttcatattattgcaataaactctgaatattac
gctgaagaaatgtcaaatgaagccaaagctcaatatcaatggctccgcgaggatcttgca
caaaatacgaaaaaatggacaattgtaatgttccatagaccatggtattgttcaagtaaa
aagaagaaaggatgtaatgatgatcaggatattctatcaagagaaggtgataagaagaag
tttccaggattagaggaattattgaatcagtataaagttgatatggtattatatggacat
aagcatacttacgagagaatgtggccaatttataataagaatccattcaaatcagcaaat
cctggacatattaagaatgcacctgcaccggtttatattttgacgggaggagcgggttgc
cattcccacgaggacccatctgatcacataatgcaagatttttctgtgaaagcacttgga
gaatatggatatacttatcttactgtatacaattcaacacatatttcaactgattatgtg
gatacttctagtacgactggaaagtttttggatccttttgttttggagaaacttaggttt
cttagtggttttttaaatgtttattttcataatgaaaaaaaatgtgccgctcattaa

DBGET integrated database retrieval system