KEGG   Caenorhabditis elegans (nematode): CELE_Y105C5B.3Help
Entry
CELE_Y105C5B.3    CDS       T00019                                 

Definition
Protein Y105C5B.3
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cel00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(15884190..15884322,15884865..15885026,15886118..15886392,15887265..15887768,15888205..15888383,15888687..15888750)
Genome map
AA seq 438 aa AA seqDB search
MILWFSLVFVLFFKASDGKAVEQVHLSLSGNPNEMVVTWLTQNPLPNVTLYALFGVSQDS
LRFTAKGNTTGWADQGKHKTMRYTHRATMQNLVPGQVYYYQVGSSQAMSSIFHFRQPDPS
QPLRAAIFGDLSIIKGQQSIDQLIEATKQNQLDVIIHIGDLAYDLHDENGATGDDYMNAI
EPFAAYVPYMVFAGNHEVDGDFNHIKNRFTMPRNGVYDNNLFWSFTYGFVHIIAINSEYY
AEEMSNEAKAQYQWLREDLAQNTKKWTIVMFHRPWYCSSKKKKGCNDDQDILSREGDKKK
FPGLEELLNQYKVDMVLYGHKHTYERMWPIYNKNPFKSANPGHIKNAPAPVYILTGGAGC
HSHEDPSDHIMQDFSVKALGEYGYTYLTVYNSTHISTDYVDTSSTTGKFLDPFVLEKLRF
LSGFLNVYFHNEKKCAAH
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgattctttggttttctctagtgtttgtgctctttttcaaagcttccgatggaaaagca
gtggagcaagtgcacctgagcctcagtggaaacccaaatgagatggtcgtgacgtggctg
acacagaatccgctaccaaatgtgactctatatgcattattcggcgtttcccaggattct
ctgagatttactgcaaaaggaaatacaactggatgggctgatcagggaaaacataaaaca
atgagatatacccatagggcaactatgcagaatttggtacccgggcaggtttattattat
caagtaggcagttcacaggcaatgtcctccattttccacttccgtcaacccgatccatct
caaccgctccgagctgcaatttttggagatttgagcattattaaaggccaacaatcaata
gatcaactaattgaagctacaaaacaaaatcaattggatgtaataattcatattggagac
ttggcatacgatttacatgatgaaaatggagcaactggagatgattatatgaatgcaatt
gagccatttgctgcatatgttccttatatggttttcgccggaaaccacgaagtcgacggg
gacttcaaccatatcaaaaaccgcttcacaatgcctagaaatggagtttacgacaacaat
cttttttggagtttcacctatggatttgttcatattattgcaataaactctgaatattac
gctgaagaaatgtcaaatgaagccaaagctcaatatcaatggctccgcgaggatcttgca
caaaatacgaaaaaatggacaattgtaatgttccatagaccatggtattgttcaagtaaa
aagaagaaaggatgtaatgatgatcaggatattctatcaagagaaggtgataagaagaag
tttccaggattagaggaattattgaatcagtataaagttgatatggtattatatggacat
aagcatacttacgagagaatgtggccaatttataataagaatccattcaaatcagcaaat
cctggacatattaagaatgcacctgcaccggtttatattttgacgggaggagcgggttgc
cattcccacgaggacccatctgatcacataatgcaagatttttctgtgaaagcacttgga
gaatatggatatacttatcttactgtatacaattcaacacatatttcaactgattatgtg
gatacttctagtacgactggaaagtttttggatccttttgttttggagaaacttaggttt
cttagtggttttttaaatgtttattttcataatgaaaaaaaatgtgccgctcattaa

DBGET integrated database retrieval system