KEGG   Caenorhabditis elegans (nematode): CELE_Y105E8A.10Help
Entry
CELE_Y105E8A.10   CDS       T00019                                 

Gene name
hpo-13
Definition
(RefSeq) HPO-13, isoform A
  KO
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CELE_Y105E8A.10 (hpo-13)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CELE_Y105E8A.10 (hpo-13)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     CELE_Y105E8A.10 (hpo-13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EnsemblGenomes-Gn: 
EnsemblGenomes-Tr: 
UniProt: 
Position
I:join(14418197..14418304,14422413..14422592,14424121..14424238,14424607..14425331,14426379..14426832,14427069..14427173,14428542..14429010,14429979..14430434,14431419..14431683)
Genome map
AA seq 959 aa AA seqDB search
MFCSFFHEKKKNILRLNIRCQRLREHDNTAKIELFKSMRRRRSSTKASRKTTMGGAAELE
DEWIPSETMSGAGWKARGDRKPKDKRVPFNRPTPYQIYEALPFVRRYFMYWMKHTFDKEK
LFINTFQPLKHKPYYGVPCGGIGCGAIGRDFRGGFCKFSLRPGLVEHKVDVVAADQFILS
VRENDRCIYQKVLSAADVQRPSGQLSTWDFKFPKKNVHYRGLFPRSWTTFRVPELELTVV
IRQVSPVLPHNYEDTTYPVCLFLIDVENGGSASREYEISVAFTFRNGTGNRRWEREAECS
GVKFETEEEGLKPTTTAQEKISGVSLYHTISSMPCTYGLATTHREHTTTTVCERFDPSRN
GAALWNHLKQTGDVPSCEEECLINAREMAVAVCNRFTLPPNSTKTHDYALSWDMPKVHFG
SVARSYHRRYTRFFEASEAGSAADSLCVRALRLKDKWESEIEAWQSPILNHKKLPDWYKS
AIFNELYFITDGGTVWFEFDENWAEHETHLSHYTKDKMKEIGRFGYLESWEYRMVNTYDV
HFYASFALAELWPELEITIQSEFTDQVYHSIEKPTRFHMEGDWANVKTASRVPHDLGNPA
DEPWIATNAYVMHDTGKWKDLNMKYVLTSWRDYVVLSNEHEDFLFHTWPAVRMIMLEALE
NWDQDGDGMIENFGKADQTYDAWQMEGVSAYCGSLWLASLRVAIEMAGLMKDDETQQLFR
NTLEKAKKVFIDTLWTGTYFRFCERSRSRETVMADQLCGYWFLQSVSPELADELLPNHMV
RSALDTIYRLNVCKFGNGRMGAVNGMKPSGVVDREYIQADEMWTGVTYAVASLLIQQGEV
EKAFHTASGSYLTCFEETGLQYQTPEALYESKFYRAIGYMRPLSIWAMQWSLKKHCGMNT
SEEKLPNLVKNEKVVPESEAAIQVQKQRILGDTSEDGSSLGYVSDYHDERSIPKIATLR
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atgttttgctccttttttcacgaaaaaaaaaagaatattttaagattaaatatccggtgt
caacgattacgggaacacgacaatactgccaaaattgagctctttaagagcatgcggaga
cgccgttcttcgacaaaagcctcgagaaaaacgacgatgggcggtgcggcggagctggaa
gatgaatggatcccgtccgagaccatgtctggagccggatggaaagctcgaggagaccgg
aaaccaaaggacaagcgggtaccgtttaataggccgacaccctatcagatctacgaggca
cttccattcgttcgtcgatattttatgtactggatgaagcacacatttgataaggagaag
ctgttcattaacacatttcaaccgctgaaacacaagccttattatggcgttccatgtgga
ggaattggatgcggagcgatcggccgtgacttccgtggtggtttctgtaaattcagcctc
cgtccagggctcgtcgagcacaaagtcgacgttgtcgccgccgatcaattcattctttcc
gtacgggaaaatgatcggtgtatctatcaaaaagtcttgtcagcagccgacgttcaacgg
ccatccgggcaactttccacgtgggatttcaaatttcccaagaaaaatgtgcattatcgg
gggctattcccccgctcgtggaccacttttcgggtacccgagcttgagctgactgtagtt
atccggcaggtgtctccggtacttccacataattatgaggatactacctaccctgtatgc
ctatttctgatcgatgttgaaaatggcggctcggcgagccgggaatacgagatctctgtc
gcttttacgtttaggaatggaaccggaaatcgaagatgggaacgagaagccgagtgttct
ggagtcaaatttgagactgaggaggagggcctgaagcctactactacggcccaagagaag
atctccggtgtcagcctgtaccatacgatctcctcgatgccttgtacctatggcctagcc
acgacacacagggaacacacgacgactacagtttgtgagagatttgatccctctcggaat
ggagcagctctgtggaatcatttgaaacagacgggcgatgtgccgagttgtgaagaagaa
tgtctcataaatgcccgtgaaatggctgtagccgtctgtaaccgcttcacccttccaccc
aactctacaaaaacccacgactatgctctgagctgggatatgccaaaagttcatttcgga
tcagttgctcgaagctatcaccgaagatatactcgatttttcgaagcttctgaagctgga
agtgcggcggattcgctgtgtgtcagagctctccggctaaaagataaatgggaatccgaa
attgaggcatggcaatcgccgattttaaatcacaaaaaactgccggattggtataaatct
gcgatctttaatgagctgtattttatcactgacggcggaactgtttggtttgaattcgat
gagaattgggctgaacacgagacacatttgagtcattatacaaaggataaaatgaaggaa
attggacgattcgggtatttggagtcttgggaatatcgaatggtgaacacgtacgatgtc
catttctacgcgtcgtttgctctcgcagagctctggccagagcttgagattacgattcaa
tcggaatttaccgaccaagtatatcactcaatcgaaaaacccacaagattccatatggaa
ggagactgggcgaacgtgaaaaccgctagccgcgtacctcatgacctcggaaatcccgcc
gatgagccatggattgccacaaatgcctatgtgatgcatgatactgggaaatggaaagat
ctcaatatgaagtatgtattaacgtcgtggcgagattacgtagtcctctcgaatgaacac
gaggattttctatttcatacgtggccggcggtacggatgattatgcttgaagcactggag
aattgggatcaagatggcgatggaatgattgagaacttcggaaaagcagatcagacttat
gatgcgtggcaaatggagggtgttagtgcgtattgtggatccttatggctcgcttctctt
cgagttgctattgaaatggccgggcttatgaaggatgatgagactcagcagctgttcagg
aatactctcgaaaaagcgaaaaaggtattcatcgacactctatggacaggaacctacttc
cgattctgtgagcgatcccgtagtagagaaacagtgatggctgatcaactatgtggttat
tggttccttcaatcagtatctcctgaactagccgacgagcttctcccgaatcatatggtc
cgatcagcgttggatacgatttatcgattgaatgtgtgtaaatttggaaacggacgaatg
ggtgcagtaaatggaatgaaaccgtcaggagtcgtagatcgggagtacattcaggctgat
gaaatgtggacgggtgttacttatgcagttgcatcgttacttattcaacagggagaagtg
gaaaaggcgtttcatacggcgtcggggagttatctgacatgttttgaggagactggacta
caatatcagacgcctgaagcactttatgaatcgaaattctaccgagccattggttacatg
cgtcctctatcgatttgggcaatgcaatggtcactaaaaaagcattgtggaatgaatacg
agtgaagaaaaattgccgaatttggtgaaaaatgaaaaagttgttccggaatccgaagca
gcaattcaagtacagaaacaacgaatattaggggatacaagtgaagatggttcgagttta
ggatatgttagtgattatcatgatgagaggagtattccaaagattgctacactacgataa

DBGET integrated database retrieval system