KEGG   Caenorhabditis elegans (nematode): CELE_Y105E8A.10Help
Entry
CELE_Y105E8A.10   CDS       T00019                                 

Gene name
hpo-13
Definition
Protein HPO-13, isoform A
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cel00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cel00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:join(14418185..14418292,14422401..14422580,14424109..14424226,14424595..14425319,14426367..14426820,14427057..14427161,14428530..14428998,14429967..14430422,14431407..14431671)
Genome map
AA seq 959 aa AA seqDB search
MFCSFFHEKKKNILRLNIRCQRLREHDNTAKIELFKSMRRRRSSTKASRKTTMGGAAELE
DEWIPSETMSGAGWKARGDRKPKDKRVPFNRPTPYQIYEALPFVRRYFMYWMKHTFDKEK
LFINTFQPLKHKPYYGVPCGGIGCGAIGRDFRGGFCKFSLRPGLVEHKVDVVAADQFILS
VRENDRCIYQKVLSAADVQRPSGQLSTWDFKFPKKNVHYRGLFPRSWTTFRVPELELTVV
IRQVSPVLPHNYEDTTYPVCLFLIDVENGGSASREYEISVAFTFRNGTGNRRWEREAECS
GVKFETEEEGLKPTTTAQEKISGVSLYHTISSMPCTYGLATTHREHTTTTVCERFDPSRN
GAALWNHLKQTGDVPSCEEECLINAREMAVAVCNRFTLPPNSTKTHDYALSWDMPKVHFG
SVARSYHRRYTRFFEASEAGSAADSLCVRALRLKDKWESEIEAWQSPILNHKKLPDWYKS
AIFNELYFITDGGTVWFEFDENWAEHETHLSHYTKDKMKEIGRFGYLESWEYRMVNTYDV
HFYASFALAELWPELEITIQSEFTDQVYHSIEKPTRFHMEGDWANVKTASRVPHDLGNPA
DEPWIATNAYVMHDTGKWKDLNMKYVLTSWRDYVVLSNEHEDFLFHTWPAVRMIMLEALE
NWDQDGDGMIENFGKADQTYDAWQMEGVSAYCGSLWLASLRVAIEMAGLMKDDETQQLFR
NTLEKAKKVFIDTLWTGTYFRFCERSRSRETVMADQLCGYWFLQSVSPELADELLPNHMV
RSALDTIYRLNVCKFGNGRMGAVNGMKPSGVVDREYIQADEMWTGVTYAVASLLIQQGEV
EKAFHTASGSYLTCFEETGLQYQTPEALYESKFYRAIGYMRPLSIWAMQWSLKKHCGMNT
SEEKLPNLVKNEKVVPESEAAIQVQKQRILGDTSEDGSSLGYVSDYHDERSIPKIATLR
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atgttttgctccttttttcacgaaaaaaaaaagaatattttaagattaaatatccggtgt
caacgattacgggaacacgacaatactgccaaaattgagctctttaagagcatgcggaga
cgccgttcttcgacaaaagcctcgagaaaaacgacgatgggcggtgcggcggagctggaa
gatgaatggatcccgtccgagaccatgtctggagccggatggaaagctcgaggagaccgg
aaaccaaaggacaagcgggtaccgtttaataggccgacaccctatcagatctacgaggca
cttccattcgttcgtcgatattttatgtactggatgaagcacacatttgataaggagaag
ctgttcattaacacatttcaaccgctgaaacacaagccttattatggcgttccatgtgga
ggaattggatgcggagcgatcggccgtgacttccgtggtggtttctgtaaattcagcctc
cgtccagggctcgtcgagcacaaagtcgacgttgtcgccgccgatcaattcattctttcc
gtacgggaaaatgatcggtgtatctatcaaaaagtcttgtcagcagccgacgttcaacgg
ccatccgggcaactttccacgtgggatttcaaatttcccaagaaaaatgtgcattatcgg
gggctattcccccgctcgtggaccacttttcgggtacccgagcttgagctgactgtagtt
atccggcaggtgtctccggtacttccacataattatgaggatactacctaccctgtatgc
ctatttctgatcgatgttgaaaatggcggctcggcgagccgggaatacgagatctctgtc
gcttttacgtttaggaatggaaccggaaatcgaagatgggaacgagaagccgagtgttct
ggagtcaaatttgagactgaggaggagggcctgaagcctactactacggcccaagagaag
atctccggtgtcagcctgtaccatacgatctcctcgatgccttgtacctatggcctagcc
acgacacacagggaacacacgacgactacagtttgtgagagatttgatccctctcggaat
ggagcagctctgtggaatcatttgaaacagacgggcgatgtgccgagttgtgaagaagaa
tgtctcataaatgcccgtgaaatggctgtagccgtctgtaaccgcttcacccttccaccc
aactctacaaaaacccacgactatgctctgagctgggatatgccaaaagttcatttcgga
tcagttgctcgaagctatcaccgaagatatactcgatttttcgaagcttctgaagctgga
agtgcggcggattcgctgtgtgtcagagctctccggctaaaagataaatgggaatccgaa
attgaggcatggcaatcgccgattttaaatcacaaaaaactgccggattggtataaatct
gcgatctttaatgagctgtattttatcactgacggcggaactgtttggtttgaattcgat
gagaattgggctgaacacgagacacatttgagtcattatacaaaggataaaatgaaggaa
attggacgattcgggtatttggagtcttgggaatatcgaatggtgaacacgtacgatgtc
catttctacgcgtcgtttgctctcgcagagctctggccagagcttgagattacgattcaa
tcggaatttaccgaccaagtatatcactcaatcgaaaaacccacaagattccatatggaa
ggagactgggcgaacgtgaaaaccgctagccgcgtacctcatgacctcggaaatcccgcc
gatgagccatggattgccacaaatgcctatgtgatgcatgatactgggaaatggaaagat
ctcaatatgaagtatgtattaacgtcgtggcgagattacgtagtcctctcgaatgaacac
gaggattttctatttcatacgtggccggcggtacggatgattatgcttgaagcactggag
aattgggatcaagatggcgatggaatgattgagaacttcggaaaagcagatcagacttat
gatgcgtggcaaatggagggtgttagtgcgtattgtggatccttatggctcgcttctctt
cgagttgctattgaaatggccgggcttatgaaggatgatgagactcagcagctgttcagg
aatactctcgaaaaagcgaaaaaggtattcatcgacactctatggacaggaacctacttc
cgattctgtgagcgatcccgtagtagagaaacagtgatggctgatcaactatgtggttat
tggttccttcaatcagtatctcctgaactagccgacgagcttctcccgaatcatatggtc
cgatcagcgttggatacgatttatcgattgaatgtgtgtaaatttggaaacggacgaatg
ggtgcagtaaatggaatgaaaccgtcaggagtcgtagatcgggagtacattcaggctgat
gaaatgtggacgggtgttacttatgcagttgcatcgttacttattcaacagggagaagtg
gaaaaggcgtttcatacggcgtcggggagttatctgacatgttttgaggagactggacta
caatatcagacgcctgaagcactttatgaatcgaaattctaccgagccattggttacatg
cgtcctctatcgatttgggcaatgcaatggtcactaaaaaagcattgtggaatgaatacg
agtgaagaaaaattgccgaatttggtgaaaaatgaaaaagttgttccggaatccgaagca
gcaattcaagtacagaaacaacgaatattaggggatacaagtgaagatggttcgagttta
ggatatgttagtgattatcatgatgagaggagtattccaaagattgctacactacgataa

DBGET integrated database retrieval system