KEGG   Caenorhabditis elegans (nematode): CELE_Y110A7A.17Help
Entry
CELE_Y110A7A.17   CDS       T00019                                 

Gene name
mat-1
Definition
(RefSeq) MAT-1, isoform A
  KO
K03350  
anaphase-promoting complex subunit 3
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CELE_Y110A7A.17 (mat-1)
Protein phosphatases and associated proteins [BR:cel01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CELE_Y110A7A.17 (mat-1)
Ubiquitin system [BR:cel04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     CELE_Y110A7A.17 (mat-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
EnsemblGenomes-Gn: 
EnsemblGenomes-Tr: 
UniProt: 
Position
I:complement(join(5124192..5124346,5124397..5124752,5124801..5125299,5125347..5125482,5125532..5125687,5125733..5125832,5125876..5126083,5126279..5126454,5126506..5126766,5126819..5126966,5127016..5127187))
Genome map
AA seq 788 aa AA seqDB search
MKESAASVAVRPQLREVFERFPADAHRTIEDEIHEMMKCYAFDDAIFLAELHYETDKSNN
SESLLLYADCLYRANKKEECYGLLSSVKLSGARLFYLLARVSYDLNKIDDCRGALFEHDD
GVIRKDILEEPRVASHANLLHAQMLCDESYMDLALESCQKSLDENILLWSAIITYLRFGG
HDLAHTFEKHHRKSNGLYLDSPASSLKSETPSPNVPGPSSSSAASTAEPSRLESSVRRST
RGTIASANRETRNTTSNITPRQSTPGSTPSRINPTAPRKSSRISEMTTRRTESSVTGSRS
SLFTEPERPHTRATHSSRNRANAALNSDTENSNASNTRTRSGIASVTRGSSSSQRTNPVR
TSIRIADAAAAANKTAKTLSQRRRNEKQPLVSRNSNLARSLSGSTNSVASTASERPSEDE
VSQINPPLPSVASSLNNDEPMDIVDGVYDPEYKKLFDVYQHIALIEESISTYNWRSADAL
FAKLDRDIILNTSMVRLQLGRACFEQSEYRECRNILDDLHKRRKWKVDGTELLSTSMWHL
QDTHALSALSQILTTESRERPQSWCAAGNCFSLQRQHTQAIECMERAIQLDKRFAYAYTL
LGHELIVQDELDKAAGSFRSALLLSPRDYRAWYGLGLVHLKKEQNLTALTNIQKAVNINP
TNRAMLCTLSQIEQQRGQIDTALVLIDRALTLNPLDVACRFNRSRLLFEANRNEECLVEL
DKLKASSPDEAFIFHLLARVHRRMGNTHLALLNYSWAAELDPRGEQNITDSNVINREEYE
DDEYGSPV
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatcagctgcgtctgtagctgtgcggcctcaattgagagaggtgttcgagcgt
tttccagcggacgcacaccgaacaattgaagatgagattcatgaaatgatgaagtgttac
gcttttgatgatgctatttttctagccgagcttcattacgaaaccgataaaagcaacaac
tccgaatctcttcttctatacgctgattgtctgtatagagccaataagaaagaggaatgt
tatggtctccttagttcagttaaattgagcggagctagactcttctatctacttgcaagg
gtatcctacgatttaaataaaatcgatgactgtagaggagctcttttcgaacatgacgat
ggagtgatacggaaagatatcctggaagagccacgggttgcatcacatgctaatttgctt
catgctcaaatgctttgcgatgaaagttacatggatctggctttagaatcttgtcaaaag
tctctggatgagaatattttgttgtggtcagctatcataacttatttacggtttggaggt
catgatctcgcccatacttttgaaaaacatcaccgaaaatcaaatggtctatacctggat
agtccagcttcgagtttgaaatccgaaacaccatcaccaaatgttcctgggccgtcgtct
tcttcagctgccagcactgctgaaccttccagactggaaagttcggtcagacgatctaca
cgcggtacgattgcttcggcgaatcgcgagacaagaaataccacatcaaacatcactcca
agacaatccactcctggatccacaccttcacgtattaatccaactgccccgagaaaaagc
tccagaatcagtgaaatgacgacacgacgtaccgaatcttcagtcactggatctcgatca
tcgttattcacagaacccgagagaccacacacgagggctacacatagctctagaaatcgc
gcaaatgctgcactaaacagcgatacggagaattcgaatgcatcgaatacgagaactcgg
agtggaattgcatcagttaccagagggtcatcgtcgtcccagaggaccaatcctgtgcgt
acttcaatcagaattgctgacgccgccgctgctgcaaacaagactgccaaaactctgagt
caaagaagacgaaatgaaaaacaacctttggtatccagaaactcaaatcttgcacggagt
ttgtcgggttctaccaattctgtggcatcaacagctagtgagcgtccatcagaagatgag
gtatcccagatcaatcctcctctcccttctgtggcttcttctttgaacaatgatgaacct
atggatattgtcgatggagtttacgatccagaatacaagaaattatttgatgtttatcaa
cacattgcacttattgaagagtcaatcagtacatacaattggagatcggctgatgcttta
ttcgcaaaactcgatagagatatcattcttaacacgtctatggtccgtcttcagttggga
agagcttgcttcgagcaatccgaatacagagagtgccggaacattctcgatgatttgcat
aaacgtagaaagtggaaggttgacggaaccgagctattgtccacctcaatgtggcacctt
caagatactcatgctctttcggctctttctcagattttgacaactgaatcacgggaacgg
ccacagagttggtgtgccgctggaaattgcttctcattacaaagacagcatactcaggca
attgaatgtatggagagggctattcaacttgacaaacgattcgcctacgcatacacttta
ttggggcatgagcttatcgttcaggatgaacttgacaaagctgcgggatctttcagatca
gcacttctcctttctcctcgcgattaccgtgcctggtatggtctcgggttggttcaccta
aagaaagagcaaaatctgactgcactgaccaatatccagaaggctgttaatattaatcca
acgaatcgtgcaatgctctgcacactgtcccaaatcgagcaacaacgtggacaaatcgat
actgctctcgtgctgattgacagggctctcactctgaatcctcttgatgtggcttgccgt
ttcaatagatcacgtctcttgtttgaggcgaatcgaaatgaagaatgtctagtggaactt
gataaattgaaagctagttcgccagatgaagcattcattttccatctgcttgcacgagtt
caccgaagaatgggaaatactcatttggctcttcttaattatagctgggcggctgagctg
gatccacgtggcgagcagaacatcactgactcgaatgttatcaatcgcgaggaatacgag
gacgacgagtacggatcgccagtataa

DBGET integrated database retrieval system