KEGG   Caenorhabditis elegans (nematode): CELE_Y116A8C.13Help
Entry
CELE_Y116A8C.13   CDS       T00019                                 

Gene name
Y116A8C.13
Definition
(RefSeq) Y116A8C.13, isoform A
  KO
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CELE_Y116A8C.13 (Y116A8C.13)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     CELE_Y116A8C.13 (Y116A8C.13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EnsemblGenomes-Gn: 
EnsemblGenomes-Tr: 
UniProt: 
Position
IV:join(16950067..16950109,16951385..16951535,16952501..16952729,16953816..16954164,16955058..16955359,16956958..16957189,16958068..16958465,16960658..16960885,16962234..16962803)
Genome map
AA seq 833 aa AA seqDB search
MSRVVLNVDSYEGNDTPSAEIARFVVLYGKASTRKHKIWEGDGLLVCFTDSCLLKSEDER
DVICRSSALKGLDQLEDGRIINIGSWSVEIQERIATGPPQKPISAQKPEIQSPMPPMTPG
NSENVENRKRGGFSSPFLGIELPKPLSKRSATFVPPLIGSESSSSGGSSSSTIQEKIPPF
ILNEQDILDRKTTSAVTVDTRFARHLRPHQKSGIQFIFDRLRRGSGKNGGGGGAILADDM
GLGKSLQTMAATWALLKGSKTAQQLANSCLIIVPSSLVNNWKAEFDKWWRLMRFPAVIAL
TANDITTYQSTIKLMPYLVISYDLAQRHVEKLKIIRFDVMVCDEGHKLKNLDGKLRKTLL
SLEIPRRLILTGTPMQNDFEEFYSLLDFVRPSVFGSIVEFRKMCSDRPEQLNELIDECML
RRTAADVDLKHLPEKHEYILFCAASPIQKHVHSEICDYMTGDALSLIFFARQLANHPKLL
LDNLREKTEKSKAHKHSPLLLAFDGAHMPRGGVKESGKLTALVDMIKCFRLLQECTVIVS
NYIETLDMIQQLCEYLNFKVLRLDGKTQVPDRQKLVRTFNDHRDPSNIFLLSTKAGGVGL
NLIGASRLVLFDSDWNPANDQQAMARIWRDGQVRPCHIYRLITTGTIEEKMLQRQIKKTG
LGCVIDAIEVGDTIATFTDEDLKDIFTFTGSATECNTHDLCECPCDGCGMLENEMDEEDD
GDDVVENDAEKIDKSGKIDKIDSDDDEEADDEELEADVTDEVVEDSQEPPEATKPAVAAA
GLRTIASLAELSRWRHFSPRHADTWHHFMTNAGLSQVDTDVELTFAFYQESQY
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgagtggttctcaacgtggatagttatgagggaaatgacaccccgagcgccgaa
atcgcccgttttgtcgttctctatggaaaagcttcgactcgaaaacacaaaatttgggaa
ggagacggtcttctcgtgtgtttcacagattcgtgtctcctgaagtcggaagatgagcgt
gacgtcatttgcagatcctcagcgctaaaaggcctggaccagcttgaagacggccgaatc
atcaatatcggatcctggagcgtcgagattcaggagagaattgctactgggcctccccag
aagcccatttcggcccaaaagcccgaaatccagagcccaatgcctccaatgacgcctgga
aactcggaaaacgtggaaaatcgcaagcgcggcggcttttcaagcccgtttttaggcatt
gagctcccaaaacctctctcaaaacgatccgccaccttcgtaccgccgcttattggctcc
gagagctcctcctccggcggctccagctcctccacaattcaggagaaaatccctccattt
atactcaacgaacaggatattctcgatcgaaaaaccacgtcagcagtcactgtggacacg
agattcgcgagacatctccgacctcatcagaaatctggaattcaatttattttcgatcgg
cttaggcgaggctccgggaaaaacggtggtggtggcggagcaattctcgccgacgatatg
ggactcggaaagagtttacagacgatggctgccacgtgggctttgttgaaaggctcaaaa
accgcccaacaactcgccaattcgtgtctaatcatcgttccatcgtctctcgtcaacaat
tggaaggcagaattcgataaatggtggcgtctaatgagatttcccgcagtaattgctctc
accgccaacgatatcaccacttatcaatcgacaatcaagctgatgccctatcttgtgatc
agttatgatttggctcaacgccacgtggaaaaactgaaaattattcgattcgacgtgatg
gtttgcgatgaggggcataaactcaagaatttggatggaaaattgcggaaaactcttctc
tcactggaaattccgcggcgcctaattctaacaggaactccaatgcaaaacgatttcgaa
gaattctactcgcttctggatttcgtgagaccttccgtattcggttcgattgtcgaattt
cgaaaaatgtgctcagatcggccggagcagctcaatgagctcatcgatgagtgcatgttg
agacgaacggctgccgatgttgatttgaaacatcttcctgaaaaacacgaatacatcctc
ttctgcgccgcctcgccaatccaaaaacatgttcattctgaaatctgcgactacatgaca
ggcgatgctctctcgttgatcttctttgcccgccaactcgccaatcatccgaagcttctt
ctcgacaatctccgtgaaaaaaccgaaaaatctaaggctcacaagcattcgccgctgctc
ctcgcgttcgatggagcacacatgccacgtggcggagttaaagaatcgggaaagctgacg
gcgttggtggatatgataaaatgtttccggcttctgcaggaatgtacagttattgtgtcg
aattatatagaaacattggatatgattcaacaactttgtgaatatttaaactttaaagtt
cttcgattggatgggaagacacaggtcccggatcgccagaaactcgtgagaacattcaat
gatcatcgcgacccatcgaacatcttcctgctcagcacaaaagccggcggcgtcgggctc
aatcttatcggagcatctcggcttgtgctcttcgactcggactggaatccggctaacgat
cagcaggctatggcaagaatctggcgggatggacaagttcggccatgccacatttatcga
ttgattaccacgggcacaatcgaggaaaagatgctccaacgacaaatcaaaaagaccggt
ctgggatgtgtgatcgacgcgatcgaggtcggcgacacgattgccacgttcaccgacgag
gatttgaaggatattttcacttttactggctcggcgaccgaatgtaatactcatgatctt
tgcgagtgcccgtgtgatggttgtggaatgcttgagaatgagatggacgaggaagacgat
ggggatgacgtggtggaaaatgatgcggaaaaaatcgataaatctggaaaaatcgataaa
atcgatagcgacgacgatgaggaagccgatgatgaggagctcgaggcggatgtgaccgat
gaagttgtggaggatagtcaggagccccccgaggccacaaaacccgccgtcgccgccgcc
ggcctccgcacgatcgcctcgctggccgaactgtcccgttggcgccacttttcgccacgt
cacgccgacacgtggcatcatttcatgacgaatgccgggttgtcgcaggtggatacggat
gtggagctgacttttgcgttttatcaagaatctcaatattga

DBGET integrated database retrieval system