KEGG   Caenorhabditis elegans (nematode): CELE_Y17G7B.7Help
Entry
CELE_Y17G7B.7     CDS       T00019                                 

Gene name
tpi-1
Definition
Protein TPI-1
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CELE_Y17G7B.7 (tpi-1)
   01230 Biosynthesis of amino acids
    CELE_Y17G7B.7 (tpi-1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CELE_Y17G7B.7 (tpi-1)
   00051 Fructose and mannose metabolism
    CELE_Y17G7B.7 (tpi-1)
   00562 Inositol phosphate metabolism
    CELE_Y17G7B.7 (tpi-1)
Enzymes [BR:cel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CELE_Y17G7B.7 (tpi-1)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CELE_Y17G7B.7 (tpi-1)
  Exosomal proteins of bladder cancer cells
   CELE_Y17G7B.7 (tpi-1)
  Exosomal proteins of melanoma cells
   CELE_Y17G7B.7 (tpi-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
II:complement(join(12037254..12037577,12038490..12038591,12038815..12039132))
Genome map
AA seq 247 aa AA seqDB search
MTRKFFVGGNWKMNGDYASVDGIVTFLNASADNSSVDVVVAPPAPYLAYAKSKLKAGVLV
AAQNCYKVPKGAFTGEISPAMIKDLGLEWVILGHSERRHVFGESDALIAEKTVHALEAGI
KVVFCIGEKLEEREAGHTKDVNFRQLQAIVDKGVSWENIVIAYEPVWAIGTGKTASGEQA
QEVHEWIRAFLKEKVSPAVADATRIIYGGSVTADNAAELGKKPDIDGFLVGGASLKPDFV
KIINARS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcaagttcttcgtcggaggaaactggaagatgaacggagactatgcctccgtc
gatggtatcgtcaccttcctcaacgcctcagccgacaattcctccgttgatgtcgtcgtt
gctccaccagctccatatctggcctacgctaaatccaagcttaaagccggtgtgcttgtc
gccgcacaaaactgctacaaagtgccaaagggagcattcaccggggaaatttcgccggca
atgatcaaggatcttggattggaatgggtgatcctcggacactcggaacgtcgtcatgtc
tttggagaaagcgatgctctgatcgctgagaagaccgtgcatgctctcgaggctggaatt
aaggtcgttttctgcattggggagaagctcgaggagcgtgaagccggacacaccaaggat
gtaaacttccgtcaacttcaagccatcgtcgacaagggtgtcagctgggagaacattgtg
atcgcctacgaaccagtttgggccatcggaaccggaaagactgcttctggagaacaagcc
caggaggttcatgaatggatccgtgcattcctcaaagagaaggtctcaccagctgtcgcc
gatgccacgagaatcatttatggaggatctgtgactgctgacaatgcggctgagcttgga
aagaagccggatatcgatggattcttggtcggtggagcatcgttgaaacccgattttgtc
aagattatcaacgccagatcttaa

DBGET integrated database retrieval system