KEGG   Caenorhabditis elegans (nematode): CELE_Y17G7B.7Help
Entry
CELE_Y17G7B.7     CDS       T00019                                 

Gene name
tpi-1
Definition
Protein TPI-1
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:cel01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cel01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cel00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cel00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cel00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
II:complement(join(12037190..12037513,12038426..12038527,12038751..12039068))
Genome map
AA seq 247 aa AA seqDB search
MTRKFFVGGNWKMNGDYASVDGIVTFLNASADNSSVDVVVAPPAPYLAYAKSKLKAGVLV
AAQNCYKVPKGAFTGEISPAMIKDLGLEWVILGHSERRHVFGESDALIAEKTVHALEAGI
KVVFCIGEKLEEREAGHTKDVNFRQLQAIVDKGVSWENIVIAYEPVWAIGTGKTASGEQA
QEVHEWIRAFLKEKVSPAVADATRIIYGGSVTADNAAELGKKPDIDGFLVGGASLKPDFV
KIINARS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcaagttcttcgtcggaggaaactggaagatgaacggagactatgcctccgtc
gatggtatcgtcaccttcctcaacgcctcagccgacaattcctccgttgatgtcgtcgtt
gctccaccagctccatatctggcctacgctaaatccaagcttaaagccggtgtgcttgtc
gccgcacaaaactgctacaaagtgccaaagggagcattcaccggggaaatttcgccggca
atgatcaaggatcttggattggaatgggtgatcctcggacactcggaacgtcgtcatgtc
tttggagaaagcgatgctctgatcgctgagaagaccgtgcatgctctcgaggctggaatt
aaggtcgttttctgcattggggagaagctcgaggagcgtgaagccggacacaccaaggat
gtaaacttccgtcaacttcaagccatcgtcgacaagggtgtcagctgggagaacattgtg
atcgcctacgaaccagtttgggccatcggaaccggaaagactgcttctggagaacaagcc
caggaggttcatgaatggatccgtgcattcctcaaagagaaggtctcaccagctgtcgcc
gatgccacgagaatcatttatggaggatctgtgactgctgacaatgcggctgagcttgga
aagaagccggatatcgatggattcttggtcggtggagcatcgttgaaacccgattttgtc
aagattatcaacgccagatcttaa

DBGET integrated database retrieval system