KEGG   Caenorhabditis elegans (nematode): CELE_Y18D10A.20Help
Entry
CELE_Y18D10A.20   CDS       T00019                                 

Gene name
pfn-1
Definition
Protein PFN-1
Orthology
K05759  
profilin
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Exosome [BR:cel04147]
 Exosomal proteins
  Proteins found in most exosomes
   CELE_Y18D10A.20 (pfn-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:join(12922040..12922165,12923010..12923282)
Genome map
AA seq 132 aa AA seqDB search
MSGWNAYIDTMTAAAPSIKRCAIVGAADGSVWARTEADNVFKASEEELKTFVALFNDVTQ
VPAKGADIEGVHYVVPRTEESLIFGKKENTGFFAVKTKSAVLIAVYEGPNEVAAQVRKAV
ESMQTYLNNAGY
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtccggatggaatgcctacatcgacacaatgactgccgctgctccatcaatcaaacgg
tgtgcaatcgtcggagccgctgatggatctgtctgggctcgtactgaggctgacaatgtg
ttcaaggcatccgaagaagagctcaaaaccttcgttgccctattcaatgacgtcactcaa
gttccagcaaaaggagccgatatcgaaggagttcattacgtcgttccacgtaccgaagaa
tcgctcatcttcggaaaaaaggagaacactggattcttcgctgtgaagaccaagtctgca
gtcttgattgctgtctacgagggaccaaatgaagttgctgcacaagttcgcaaggctgtc
gagagtatgcaaacctatctcaacaatgctggatactaa

DBGET integrated database retrieval system