KEGG   Caenorhabditis elegans (nematode): CELE_Y19D10A.16Help
Entry
CELE_Y19D10A.16   CDS       T00019                                 

Definition
Protein Y19D10A.16
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cel00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cel00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
V:join(2392771..2392915,2393012..2393166,2393215..2393313,2393502..2394014,2394066..2394146)
Genome map
AA seq 330 aa AA seqDB search
MASGFIEIANKQGLTATLLPFGATLAKLTFPDKNGKNQDLVLGFDTIDEFEKDAASIGKT
VGRVANRIKNSTLHFDGKQYTMTPNNGPHYLHGGPNGLGYRKWEVVRHAPESVSFSVRAN
EQDDGLPGDAKIDVTYTVNDRNQLIIEHHATCDTPGLLALTNHAYWNLDGSDTVAEHFLE
MEADEFVEVDDTFCPTGAIRSVTDTGFDFRSGKQLKESGKDAEELLDLDNDLVITKKTPP
STPSTYLRFWSEKSGIELSITTSYPVIHLYASKFLDCKGKKGEHYKANKALAIEPQFHSA
APNFDHFPDVSLRPGDHYCQEIVYTFSHVN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaggattcatcgaaattgcaaacaagcagggtctcaccgcgactcttctcccg
ttcggtgccacgttggcaaaattaacatttccggacaaaaacggaaagaatcaggatttg
gtgttaggatttgacactattgatgaattcgaaaaagacgccgcctctattggaaagact
gtcggaagagtcgcgaatcgaatcaaaaactcgacattacactttgacgggaaacagtac
acaatgacgcccaacaacgggccgcattatcttcacggcgggcccaatggactgggatat
agaaaatgggaagtagtccgccacgctccagagtcggtttcctttagcgttcgggccaat
gagcaggatgacgggcttcctggcgatgcgaaaattgatgtaacctacactgtaaatgac
cgtaaccagctcatcatcgagcaccacgcgacatgcgacaccccgggcctgctcgctctc
accaatcacgcctactggaacctagacggctcggataccgtcgccgagcactttctggag
atggaagccgacgagttcgtggaggtggacgatacgttctgcccaactggagccatccga
tccgtcaccgacaccggattcgattttcggagtgggaagcagctgaaagagtcggggaag
gacgcggaggagttgctggatttggataatgatttagtgatcactaagaagaccccgcca
tcaactccatcgacttacttgagattttggagcgaaaagtctggaattgaactttccatc
acaacttcttacccggttattcatctctatgcgtcgaaatttttggattgtaaaggcaaa
aagggggagcattacaaggccaacaaggcgttggcaatcgagccacaattccactcggca
gctccaaattttgatcacttccccgacgtctctcttcgcccgggagaccactactgtcag
gagattgtctacacattttctcatgttaattga

DBGET integrated database retrieval system