KEGG   Caenorhabditis elegans (nematode): CELE_Y19D10A.16Help
Entry
CELE_Y19D10A.16   CDS       T00019                                 

Gene name
Y19D10A.16
Definition
Protein Y19D10A.16
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CELE_Y19D10A.16 (Y19D10A.16)
   00052 Galactose metabolism
    CELE_Y19D10A.16 (Y19D10A.16)
Enzymes [BR:cel01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     CELE_Y19D10A.16 (Y19D10A.16)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
V:join(2392772..2392916,2393013..2393167,2393216..2393314,2393503..2394015,2394067..2394147)
Genome map
AA seq 330 aa AA seqDB search
MASGFIEIANKQGLTATLLPFGATLAKLTFPDKNGKNQDLVLGFDTIDEFEKDAASIGKT
VGRVANRIKNSTLHFDGKQYTMTPNNGPHYLHGGPNGLGYRKWEVVRHAPESVSFSVRAN
EQDDGLPGDAKIDVTYTVNDRNQLIIEHHATCDTPGLLALTNHAYWNLDGSDTVAEHFLE
MEADEFVEVDDTFCPTGAIRSVTDTGFDFRSGKQLKESGKDAEELLDLDNDLVITKKTPP
STPSTYLRFWSEKSGIELSITTSYPVIHLYASKFLDCKGKKGEHYKANKALAIEPQFHSA
APNFDHFPDVSLRPGDHYCQEIVYTFSHVN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaggattcatcgaaattgcaaacaagcagggtctcaccgcgactcttctcccg
ttcggtgccacgttggcaaaattaacatttccggacaaaaacggaaagaatcaggatttg
gtgttaggatttgacactattgatgaattcgaaaaagacgccgcctctattggaaagact
gtcggaagagtcgcgaatcgaatcaaaaactcgacattacactttgacgggaaacagtac
acaatgacgcccaacaacgggccgcattatcttcacggcgggcccaatggactgggatat
agaaaatgggaagtagtccgccacgctccagagtcggtttcctttagcgttcgggccaat
gagcaggatgacgggcttcctggcgatgcgaaaattgatgtaacctacactgtaaatgac
cgtaaccagctcatcatcgagcaccacgcgacatgcgacaccccgggcctgctcgctctc
accaatcacgcctactggaacctagacggctcggataccgtcgccgagcactttctggag
atggaagccgacgagttcgtggaggtggacgatacgttctgcccaactggagccatccga
tccgtcaccgacaccggattcgattttcggagtgggaagcagctgaaagagtcggggaag
gacgcggaggagttgctggatttggataatgatttagtgatcactaagaagaccccgcca
tcaactccatcgacttacttgagattttggagcgaaaagtctggaattgaactttccatc
acaacttcttacccggttattcatctctatgcgtcgaaatttttggattgtaaaggcaaa
aagggggagcattacaaggccaacaaggcgttggcaatcgagccacaattccactcggca
gctccaaattttgatcacttccccgacgtctctcttcgcccgggagaccactactgtcag
gagattgtctacacattttctcatgttaattga

  All links  
No link information was found.   
DBGET integrated database retrieval system