KEGG   Caenorhabditis elegans (nematode): CELE_Y39A1C.4Help
Entry
CELE_Y39A1C.4     CDS       T00019                                 

Gene name
hex-3
Definition
Protein HEX-3
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CELE_Y39A1C.4 (hex-3)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CELE_Y39A1C.4 (hex-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(10849253..10849390,10850150..10850779,10851716..10852129,10852730..10853080,10854027..10854269)
Genome map
AA seq 591 aa AA seqDB search
MLRGFFGRRSRSAWVRLIYLCIVTIIFLFATSQFKSTTTHARFVPEPSDPRLHPNSPLQA
PKAQEPAAAETTKKPSRQPHHTTAKPRTENVEINGEKYPKLSPDGNLIPQRRIVHLDLKG
APYKPEFFTELFAFFNRIQATGILLEWEDMFPFKGRLRGAINKNAYSMETVEHILQEAQK
HHLQIIPLVQTMGHLEWILKLEEFAHLREDTRFPQVICFSDENAWELIKEMIEEVANVHK
KYGMSYFHIGADEAFQIGICNASITQIKKEFTRERLMLWHIARTARFVKEKYPETQVLAW
HDMLASAMESDIEDYKLTELLQPVLWNYAEDLDIYLPRSTWMILRNFRNVWGSSAWKGAD
GPARYSTNANHYLKNHESWIKQFTMVYKDFEVVEGLIMAGWSRYDHFAVLAETIPVALPT
LAMSMETMIEGRPLAGNYPVTSELLQCTPPLDLGFTATGCKFPGNRIYELINEMYQKQMQ
LRTYRLDDYELNGWLSRVADDYSVSSHWYIDKIENMIEMHATPLEQLADDLRFEMERIFF
KDTVDEFIFTYLGEDLEWFNRKRETIRKVSTSQTFPKRPFIESAKSEKTCT
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaggttttttcgggcgccgctcgcggtcagcatgggttcggctcatttatttg
tgcatcgtcacaataatcttccttttcgccacatcacagttcaaatcgacgacaactcac
gcgagattcgtgccagagccctcggatccgcgtctccacccaaattcaccacttcaagct
ccaaaagctcaggagccagcagctgcagaaaccacgaaaaagccgtctcgtcaaccccac
cacacaactgcaaaaccaagaactgaaaatgtagaaataaacggagaaaaatacccgaaa
ctctctccagacggaaatctcattccacaacgtcgaattgttcatttggatttgaaagga
gcaccctataaaccagaatttttcactgaactcttcgcatttttcaatagaattcaagcg
acaggaattcttctcgaatgggaagatatgttcccatttaaaggccggctccgcggagca
atcaataaaaatgcctattctatggagaccgttgagcacattctacaagaagcccaaaag
catcatttacaaattatcccacttgttcagacaatgggacacttggaatggatactgaaa
cttgaagaatttgctcatttgagagaggatacacgattccctcaagttatatgcttttcc
gatgaaaatgcgtgggaattgattaaagaaatgattgaggaagttgcaaatgtgcataaa
aaatatggaatgagctattttcatattggagccgatgaggcttttcagatcggaatctgc
aatgctagcatcactcaaataaaaaaagaattcacccgtgaacgtctaatgctttggcat
attgctcgaactgcacgcttcgtaaaagaaaagtatccagaaactcaagttctagcgtgg
catgatatgttggcaagtgcaatggaatcagatattgaagattataagctcacggagcta
ttgcaaccagttttatggaattatgcagaagatcttgatatctaccttccccgttcaaca
tggatgattcttcggaatttccgaaatgtttggggaagttctgcatggaaaggagctgat
ggaccggcgagatattcgacgaatgccaatcattatttgaagaatcatgaatcttggatt
aagcagtttacaatggtttataaggattttgaagttgttgagggtctaataatggctggt
tggtcccggtacgatcatttcgccgtacttgccgaaacaattcccgtagcccttccgaca
cttgcaatgagtatggaaacaatgattgaaggacgtccacttgctggaaattatcctgta
acttcggaacttttacaatgtacaccacctcttgatttgggatttactgccactggatgc
aaatttccggggaatcgaatctatgaattgattaatgaaatgtatcaaaaacaaatgcaa
ttgagaacatatcgactggatgattatgagcttaatggatggttatccagagttgctgat
gattattccgtttctagtcattggtatattgataaaatcgagaatatgatcgaaatgcac
gctactccactggaacaattagccgacgatctccgcttcgaaatggagagaatctttttc
aaggacactgtcgatgagttcatattcacatatttaggcgaagatcttgaatggttcaat
aggaaacgtgagacaattcgcaaagtttcaacgtcacaaacattcccgaaacgaccgttt
attgaatcggcgaaaagcgaaaaaacttgtacatag

DBGET integrated database retrieval system