KEGG   Caenorhabditis elegans (nematode): CELE_Y40B1B.5Help
Entry
CELE_Y40B1B.5     CDS       T00019                                 

Definition
(RefSeq) EIF-3.J
  KO
K03245  
translation initiation factor 3 subunit J
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CELE_Y40B1B.5
Translation factors [BR:cel03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    CELE_Y40B1B.5
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EnsemblGenomes-Gn: 
EnsemblGenomes-Tr: 
UniProt: 
Position
I:join(13435505..13435925,13436753..13436835,13437575..13437709)
Genome map
AA seq 212 aa AA seqDB search
MSDWEDDDFEPEVSTFKRAEPAPEPVKIVDAPPPPQKAAPAAPKTLKAAPTFAMESLGRE
LTSAEKEAIQKKNDLALARDLFGDDDSAEATDEAKTYANIMSKADFEYWGERVGGFLASR
SKASCYGDMIGKLLTSVTDEMTPAEILKMVTFLQQISAAKKTAEKTKAKATTAAKPAAAA
NKKNAKATLKVTKGNDSMYDDYGDDQDDYDDY
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtccgactgggaagacgacgatttcgagcccgaggtgtcgacgttcaagcgtgcggag
ccagctccagagcccgtgaaaatcgtcgacgcaccaccgccaccacagaaagccgctccc
gcagctccgaaaactctgaaagccgctccaacattcgccatggaatcacttggacgagaa
ctgacgtcggctgaaaaagaagcgatacagaagaaaaatgatctcgcgttggctcgtgat
ttgttcggagatgatgattctgctgaagccactgacgaagcgaagacctatgcgaatatc
atgtcgaaagccgatttcgagtactggggagagcgtgtcggtggatttttggcttcacgg
agtaaagcatcctgttatggagatatgattggaaaacttctcacttccgtcactgatgag
atgacacccgccgaaatcctgaaaatggtcaccttccttcaacagatcagcgccgccaag
aagactgccgagaagacgaaagcgaaggccaccaccgccgcaaaaccagctgcagctgcc
aacaaaaagaacgcgaaggcaacgctgaaagtgacgaagggaaatgacagcatgtacgac
gattacggagacgaccaagacgattatgatgattattga

DBGET integrated database retrieval system