KEGG   Caenorhabditis elegans (nematode): CELE_Y40G12A.1Help
Entry
CELE_Y40G12A.1    CDS       T00019                                 

Gene name
ubh-3
Definition
(RefSeq) Ubiquitin carboxyl-terminal hydrolase
  KO
K05609  ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CELE_Y40G12A.1 (ubh-3)
Peptidases [BR:cel01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CELE_Y40G12A.1 (ubh-3)
Ubiquitin system [BR:cel04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    CELE_Y40G12A.1 (ubh-3)
  UBL-specific proteases (ULPs)
   CELE_Y40G12A.1 (ubh-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C12
Motif
Other DBs
NCBI-GeneID: 259626
NCBI-ProteinID: NP_504653
WormBase: WBGene00006723
Ensembl: WBGene00006723
UniProt: Q965V9
Position
V:complement(join(6506893..6507032,6507088..6507207,6508331..6508691,6508741..6508803))
Genome map
AA seq 227 aa AA seqDB search
MTTKGKGGWQALESNPETINPFLKKIGITGLECVDVYSFDDEMLQFVPTPQLALILCFPS
AEAREFLSKQYEEVEKNGEKPEGVFFMNQSEEIGNACGTFALFHSLANLENRVNLGKGKF
AKWYEKAKLVNEDERSDLLSGDTDLAEAHEETAEEGETEQSDHVDYHFITYVNKNGQLYE
IDSCAPFPRPLGATTDSTMIKDASTAIKELMNNVKNLSFSAMALVGK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgactacaaaaggaaagggaggctggcaagctttggaatcaaatccagaaactatcaac
ccgtttctcaaaaaaatcggaataaccggattggaatgtgtcgatgtctactcgttcgat
gacgagatgctccaattcgttccaacaccacaacttgctctgattctgtgctttccaagc
gcagaagcacgcgaatttctgtcgaaacaatatgaggaagtggagaagaatggagaaaag
ccggaaggagtgttctttatgaatcaaagcgaagaaattggaaatgcttgtggaacattt
gccttgtttcattcgttggcaaatcttgaaaatcgtgtgaatcttggcaaaggaaagttc
gcaaagtggtatgagaaggcgaaattggtcaatgaagatgagcggtctgatttgttatct
ggagacactgatcttgcggaagcgcacgaagaaaccgccgaggaaggagaaactgaacaa
tcggatcacgttgattaccacttcatcacctatgtcaacaagaatggacaactctacgaa
atcgactcatgtgctccatttccacgtccactcggagccaccaccgactctacaatgatc
aaggatgcatctacagctatcaaagaactgatgaacaatgttaagaatctcagcttctct
gctatggctcttgttggaaaataa

DBGET integrated database retrieval system