KEGG   Caenorhabditis elegans (nematode): CELE_Y44E3A.2Help
Entry
CELE_Y44E3A.2     CDS       T00019                                 

Gene name
ace-2
Definition
Protein ACE-2
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CELE_Y44E3A.2 (ace-2)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     CELE_Y44E3A.2 (ace-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:complement(join(3302197..3302321,3302494..3302654,3303168..3303341,3303867..3304291,3305177..3305413,3305460..3305688,3305944..3306119,3306224..3306427,3307307..3307465))
Genome map
AA seq 629 aa AA seqDB search
MRAPVIGRHLTYHVFCQFALVTLFIVRRIEPRSIVRGDHVVHTPLGTIRGVGQTFDGAKV
SAFLGVPYAKPPIGSRRFKMAEMIDRWSGELEARTLAKTCYLTIDSAFPQFPGAEMWNPP
GAISEDCLNMNIWVPEDHDGSVMVWIYGGGFFSGTPSLDLYSGSVFAAKEHTIVVNVNYR
LGPFGFLYFGDDSPIQGNMGLMDQQLALRWVHENIGAFGGDRSRVTLFGESAGSASTTAH
LFAPNSHKYFRNIIAKSGSIINSWASATPPTMLDLSFRLAKKVNCSSPDMNAIVKCLRSV
PAHLVQAEADNISGDIGPPMTFAYVPVSSDANFFQGDVFQKLANKQFKKDVNIIFGSVKD
EGTYWLPYYMSLPKYGFAFNHTISAEDPHNRALITRDHYEESMRAFMPYFAGSKLVLNAF
MNSYEHVSTSNVPEERYRDGVARFLGDLFFTCSLIDFADLISDNIFGNVYMYYFTYRSSA
NPWPKWMGVMHGYEIEYAFGQPYWRPHLYDQTHLEDEKRLSSIIMQIWANFANTGRTDSF
WPQYNKIERKAIELGETTLQGKHRIISDVHGGFCRMIDEAKAFVKQKNANDCRTTRKSAS
TEDLTSSSSTTYLFSIIVYLSILISYISL
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcgcccgtcatcggacggcatctcacttatcacgtcttctgtcagttcgcgcta
gttacacttttcattgttaggcggatcgagccacggtcgatcgttcgaggagatcatgtc
gtgcacacgccgctgggaacaatacggggcgtcggacagactttcgacggtgcaaaagta
tctgcattccttggtgtcccgtacgcaaaacctccaatcggttcaagacgtttcaagatg
gcggagatgatcgatcggtggagtggggaactcgaagctcggacacttgcgaagacatgc
tacttgacaattgattcggcgtttccacagttccctggtgctgaaatgtggaatccccct
ggggcaatttcggaagactgtctaaatatgaacatttgggtgccggaagatcacgatgga
tcggtgatggtatggatctatggaggagggtttttcagtgggactccatctctggatctt
tacagtggatccgtattcgctgcgaaggagcacacaatcgtggtcaatgtgaattacagg
ctgggcccattcggatttctctacttcggagatgattctccgattcaaggaaacatgggc
ttaatggatcaacagcttgctcttcgttgggttcacgagaatatcggagcattcggaggc
gatcggtcacgggtcactttgttcggagaatcagctggatccgcctcgacgactgctcat
ctgtttgccccgaattcacataaatattttagaaatattattgcaaagagtggctcaata
atcaactcatgggcatcagcaactccaccaacaatgcttgatctttcgtttcgtctcgcg
aaaaaagtgaactgtagctcaccggatatgaatgcaattgtcaagtgtcttcgaagtgtt
ccagcacatctagttcaagcagaagctgataatatttctggagatattgggccaccgatg
acatttgcatacgttcctgtttcgtcggacgccaatttcttccagggcgacgtattccaa
aaactggcgaataagcaattcaaaaaagacgtgaacataatattcggaagtgtaaaagac
gaaggaacatactggctaccctattacatgtcacttcccaaatatggatttgcattcaat
cacacaatatcggctgaagatcctcataatcgagccctgattacacgagatcattatgaa
gaatcaatgagagcattcatgccatattttgctggttcgaaacttgtattgaatgcattt
atgaattcttatgagcatgtatcgactagtaatgtacctgaagaacgatatcgggatgga
gttgctcgattcttgggagacttgttttttacttgctctcttattgattttgctgatttg
atatcggataacatttttggaaatgtttatatgtactactttacctacaggtcaagcgca
aatccatggccaaagtggatgggtgtaatgcatggatatgaaatagaatatgcatttggt
caaccatattggagacctcacctctatgatcagactcacctggaagatgagaaacgactt
tcttctattataatgcaaatttgggcaaattttgcaaatactggaagaaccgactcattt
tggccgcaatataacaaaatcgagcggaaggcgattgagctgggagagacaacattacaa
gggaagcatcgaatcatttctgatgttcatggaggattttgtagaatgattgatgaggca
aaggcgtttgtgaaacagaaaaatgcaaacgactgccgtacaactcgaaaatccgcatcc
accgaagatctgaccagctccagctcaacgacctacctcttctccataattgtttatctg
tctattctaatctcttatatcagtttgtga

DBGET integrated database retrieval system