KEGG   Caenorhabditis elegans (nematode): CELE_Y47G6A.6Help
Entry
CELE_Y47G6A.6     CDS       T00019                                 

Gene name
pcaf-1
Definition
Protein PCAF-1
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:cel04330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:join(3516555..3516671,3516728..3516848,3516903..3517030,3517808..3517962,3518026..3518117,3518168..3518268,3519262..3520166,3521306..3521410,3521460..3521587,3522311..3522579,3523071..3523253)
Genome map
AA seq 767 aa AA seqDB search
MKQRDSLDEKRRQLTYFTSCNAGTCQCRGFRPVLNHEDETVERRATRAERENDFAPMTRD
LETLGSEEIIECRTCGHSISFHAEPLKYLSQEDLDTYTDQISDLQTCCSELSEIDPSHES
LQTLYITMQILLKSLRTLTPVDVPFIGKPNFEPESLSPYILVKKFIASRPVDNAEKQRLA
EIGTLFLTEMNHWKLEGFQSLADKLNVPLEQGKYRMMYVRMDYYVNMPAKYVSFKQFQTV
DIFGEKFTTTFCNYLINVLNTGNYTPFGLSESDLEENSEDLITFATDLRRYLETEDPQST
STTNRRKDSISTEDVILKYVKRKKPTDHSESSSPRELSTSPVEEPRRRKKEPSSSAKKSP
ETEESMALLRSLIRAIKFEGDLDAMEPKTKVEFEALNTEVSRGLSALQEEESGLIEFRVI
GNDLDPFQHHEQLVHLVELQNLFGAQLPKMPKEYVTRLIFDSRHQNMVILKRDMGVIGGI
CFRTFPSRGFVEIVFCAITAMEQVKGYGTHLMNHCKDYMIKNKIYHMLTYADEFAIGYFT
KQGFSEKLEINDTVYQGWIKEYEGATLMGCHLHPQISYTKFPDFSKGIQALHCGYKSENG
AESRGKVFGGLEHLFRESSPQLLELRKVPGTDSLKMHKKSCYHLDERDDSLDSKIGAILK
KLTADKNAWPFASPVDVKEVPEYYDHIKHPIDFKTMQEKLKRKAYTHQHLFIADLNRLFQ
NCYVFNGAEAVYYKYGYKLNELALKLLKTSFPESSWYPELPEQKPLC
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacgcgactctctggatgaaaaacgacgacaattaacatatttcacgtcttgc
aacgccggaacatgccaatgccgtggtttccggcctgttttgaatcacgaagatgagact
gtcgaacggcgagcaacacgagcagaaagagaaaatgattttgcaccgatgactagggat
ctggaaactttgggaagcgaggagataatcgaatgccgaacgtgtggtcattctatatct
tttcatgcggagccactaaaatatttgtcacaagaggatctggacacgtatacggatcaa
atttccgaccttcaaacctgttgctctgaactttcagaaatcgatccttctcatgaatct
cttcagacgctatacatcacaatgcaaattctcctgaaatcccttcgcacactaacgccc
gtcgatgtgccttttatcggaaaaccaaattttgaaccggaatccctaagcccatatatt
cttgtgaagaagtttatcgcatcccgaccagttgataatgccgaaaaacaacgattagcc
gaaattggaacgctttttctaactgaaatgaaccactggaagcttgaaggatttcagagt
cttgcggataaattaaatgtgcctctcgaacagggaaaatatcgaatgatgtatgtaaga
atggattattatgtgaatatgccggcgaaatacgtgtcttttaagcagtttcagacagtg
gacatattcggcgagaagttcaccacaacattctgtaattatctaataaatgtgctgaat
acgggcaactatacaccattcggcctttcggaaagtgatttagaagagaatagcgaagat
ttgatcacatttgcaacggatttgaggcgatatttagagactgaagatccacaatcaacc
tccaccacaaatcgacgaaaagattcaatttctacagaagacgtcattttgaaatatgta
aaacggaaaaagccaacggatcattctgaaagttcatctccacgtgagctctccacttca
cctgtggaagagccccgtcgcaggaagaaagagccctcaagctccgcaaaaaaatcccca
gaaactgaagaatcaatggctctactgcgttctctgattcgggcgatcaagttcgaaggc
gacctggatgcaatggaaccgaagacaaaagtcgaatttgaagctcttaatacagaagtt
tcacgaggtctaagtgctctacaggaagaggagagtgggctcattgagttccgagtaatt
ggaaatgatcttgatccatttcaacatcacgagcaacttgttcatcttgttgagcttcaa
aatctatttggagcacagcttccgaagatgcccaaagaatatgtgacacggttgattttt
gactcgaggcatcaaaatatggtgattttgaagcgagatatgggagttatcggtggaatt
tgcttccgaacattcccttcacggggatttgtggaaattgtattttgtgcaattactgca
atggaacaggtcaaaggatatggaacacatttgatgaatcattgtaaagattatatgatt
aaaaataagatttatcatatgctaacctatgctgatgaatttgcaattggctattttaca
aagcaaggattctctgaaaagctggaaatcaacgatacagtctatcagggatggattaaa
gaatatgaaggtgcaactttaatgggttgtcatctacatccacaaatctcgtacacaaaa
tttccggatttctcgaaaggaattcaggctctacactgtggatacaagtcggaaaatgga
gcagaaagccgtggaaaagtgtttggaggacttgagcatcttttcagagaaagttcccca
caacttctcgagctccgaaaagtgccgggcacggattcgcttaaaatgcacaaaaagtcg
tgttaccatctggacgaacgagacgatagtcttgactcaaaaattggagcaattctgaag
aagctgaccgccgataaaaatgcatggccgtttgcaagtccagttgatgtgaaagaagta
ccagaatattatgatcatattaagcatccgatcgattttaaaacaatgcaagaaaaattg
aaacggaaggcttatactcatcaacacttgttcatagccgacctgaatcgcctcttccaa
aactgttacgtgttcaacggagctgaagctgtctactataaatatggctataaactgaac
gaactggcgctgaaacttctgaaaacgtcgttcccggagagctcgtggtatccagagctc
cccgagcaaaaacctctatgttaa

DBGET integrated database retrieval system