KEGG   Caenorhabditis elegans (nematode): CELE_Y47G6A.6Help
Entry
CELE_Y47G6A.6     CDS       T00019                                 

Gene name
pcaf-1
Definition
Protein PCAF-1
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    CELE_Y47G6A.6 (pcaf-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CELE_Y47G6A.6 (pcaf-1)
Transcription machinery [BR:cel03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CELE_Y47G6A.6 (pcaf-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:join(3516552..3516668,3516725..3516845,3516900..3517027,3517805..3517959,3518023..3518114,3518165..3518265,3519259..3520163,3521303..3521407,3521457..3521584,3522308..3522576,3523068..3523250)
Genome map
AA seq 767 aa AA seqDB search
MKQRDSLDEKRRQLTYFTSCNAGTCQCRGFRPVLNHEDETVERRATRAERENDFAPMTRD
LETLGSEEIIECRTCGHSISFHAEPLKYLSQEDLDTYTDQISDLQTCCSELSEIDPSHES
LQTLYITMQILLKSLRTLTPVDVPFIGKPNFEPESLSPYILVKKFIASRPVDNAEKQRLA
EIGTLFLTEMNHWKLEGFQSLADKLNVPLEQGKYRMMYVRMDYYVNMPAKYVSFKQFQTV
DIFGEKFTTTFCNYLINVLNTGNYTPFGLSESDLEENSEDLITFATDLRRYLETEDPQST
STTNRRKDSISTEDVILKYVKRKKPTDHSESSSPRELSTSPVEEPRRRKKEPSSSAKKSP
ETEESMALLRSLIRAIKFEGDLDAMEPKTKVEFEALNTEVSRGLSALQEEESGLIEFRVI
GNDLDPFQHHEQLVHLVELQNLFGAQLPKMPKEYVTRLIFDSRHQNMVILKRDMGVIGGI
CFRTFPSRGFVEIVFCAITAMEQVKGYGTHLMNHCKDYMIKNKIYHMLTYADEFAIGYFT
KQGFSEKLEINDTVYQGWIKEYEGATLMGCHLHPQISYTKFPDFSKGIQALHCGYKSENG
AESRGKVFGGLEHLFRESSPQLLELRKVPGTDSLKMHKKSCYHLDERDDSLDSKIGAILK
KLTADKNAWPFASPVDVKEVPEYYDHIKHPIDFKTMQEKLKRKAYTHQHLFIADLNRLFQ
NCYVFNGAEAVYYKYGYKLNELALKLLKTSFPESSWYPELPEQKPLC
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacgcgactctctggatgaaaaacgacgacaattaacatatttcacgtcttgc
aacgccggaacatgccaatgccgtggtttccggcctgttttgaatcacgaagatgagact
gtcgaacggcgagcaacacgagcagaaagagaaaatgattttgcaccgatgactagggat
ctggaaactttgggaagcgaggagataatcgaatgccgaacgtgtggtcattctatatct
tttcatgcggagccactaaaatatttgtcacaagaggatctggacacgtatacggatcaa
atttccgaccttcaaacctgttgctctgaactttcagaaatcgatccttctcatgaatct
cttcagacgctatacatcacaatgcaaattctcctgaaatcccttcgcacactaacgccc
gtcgatgtgccttttatcggaaaaccaaattttgaaccggaatccctaagcccatatatt
cttgtgaagaagtttatcgcatcccgaccagttgataatgccgaaaaacaacgattagcc
gaaattggaacgctttttctaactgaaatgaaccactggaagcttgaaggatttcagagt
cttgcggataaattaaatgtgcctctcgaacagggaaaatatcgaatgatgtatgtaaga
atggattattatgtgaatatgccggcgaaatacgtgtcttttaagcagtttcagacagtg
gacatattcggcgagaagttcaccacaacattctgtaattatctaataaatgtgctgaat
acgggcaactatacaccattcggcctttcggaaagtgatttagaagagaatagcgaagat
ttgatcacatttgcaacggatttgaggcgatatttagagactgaagatccacaatcaacc
tccaccacaaatcgacgaaaagattcaatttctacagaagacgtcattttgaaatatgta
aaacggaaaaagccaacggatcattctgaaagttcatctccacgtgagctctccacttca
cctgtggaagagccccgtcgcaggaagaaagagccctcaagctccgcaaaaaaatcccca
gaaactgaagaatcaatggctctactgcgttctctgattcgggcgatcaagttcgaaggc
gacctggatgcaatggaaccgaagacaaaagtcgaatttgaagctcttaatacagaagtt
tcacgaggtctaagtgctctacaggaagaggagagtgggctcattgagttccgagtaatt
ggaaatgatcttgatccatttcaacatcacgagcaacttgttcatcttgttgagcttcaa
aatctatttggagcacagcttccgaagatgcccaaagaatatgtgacacggttgattttt
gactcgaggcatcaaaatatggtgattttgaagcgagatatgggagttatcggtggaatt
tgcttccgaacattcccttcacggggatttgtggaaattgtattttgtgcaattactgca
atggaacaggtcaaaggatatggaacacatttgatgaatcattgtaaagattatatgatt
aaaaataagatttatcatatgctaacctatgctgatgaatttgcaattggctattttaca
aagcaaggattctctgaaaagctggaaatcaacgatacagtctatcagggatggattaaa
gaatatgaaggtgcaactttaatgggttgtcatctacatccacaaatctcgtacacaaaa
tttccggatttctcgaaaggaattcaggctctacactgtggatacaagtcggaaaatgga
gcagaaagccgtggaaaagtgtttggaggacttgagcatcttttcagagaaagttcccca
caacttctcgagctccgaaaagtgccgggcacggattcgcttaaaatgcacaaaaagtcg
tgttaccatctggacgaacgagacgatagtcttgactcaaaaattggagcaattctgaag
aagctgaccgccgataaaaatgcatggccgtttgcaagtccagttgatgtgaaagaagta
ccagaatattatgatcatattaagcatccgatcgattttaaaacaatgcaagaaaaattg
aaacggaaggcttatactcatcaacacttgttcatagccgacctgaatcgcctcttccaa
aactgttacgtgttcaacggagctgaagctgtctactataaatatggctataaactgaac
gaactggcgctgaaacttctgaaaacgtcgttcccggagagctcgtggtatccagagctc
cccgagcaaaaacctctatgttaa

DBGET integrated database retrieval system