KEGG   Caenorhabditis elegans (nematode): CELE_Y48B6A.7Help
Entry
CELE_Y48B6A.7     CDS       T00019                                 

Gene name
ace-4
Definition
Protein ACE-4
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CELE_Y48B6A.7 (ace-4)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     CELE_Y48B6A.7 (ace-4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:join(14198092..14198142,14198752..14198858,14198913..14199134,14199183..14199261,14200233..14200349,14200732..14200791,14200849..14200919,14200966..14201089,14201552..14201661,14201729..14201829,14201966..14202032,14203447..14203639,14203717..14203802,14204620..14204775,14204876..14204944,14204993..14205099,14205162..14205250)
Genome map
AA seq 602 aa AA seqDB search
MKPKLAFFAFFIFITVFIDSVQAVHPVVLETKLGDIKGTEFFFLSKKIRTFFGVPFAEPA
VEDFRFRKPREKKQWRGLYDATKPANACFQTRDNYNTSFWGSEMWNANTQISEDCLYLNI
WAPADAYNLTVMVWFFGGGFYSGSPSLSIYDGKALTSTQNVIVVNINYRLGPFGFLYLGH
PDAPGNMGLLDQQLALHWVRQNIVSFGGNPDKVAVFGQSAGAASIVAHLIAPGSRGLFKN
AILQSGSLENTWAINSPFRAKQKSEKLLELVGCNKTTVDTSMACLRLVSPEQLSLSTWNI
SLTYLEFPFVIVSRDKHFFGHLDAHAALREGDFNRDVNLMIGMNKDEGNYWNIYQLPQFF
DKADPPELNRTEFDFLIDRTFSIQPDIIRSAAKYIYSDPNCTDHGRKTRFYAGQMNQIVG
DYFFSCDSLWLADQFRSIPRVKSSSPQRKPGKVFVYHFTQSSSANPWPKWTGAMHGYEIE
YVFGIPLSYSKNYKRREQIFSRKIMQFWASFAKNGTPKLRVLKNSEHWPEFNEQNHYRWM
QLRSGSNIRPIKPKKQVECQFWRRVKDTEYTAYLTQEYSSSSLTTYSYWLLLYIPLFIFQ
IF
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaaaacttgcgttcttcgcgtttttcatttttattactgtttttatcgattca
gtgcaggcggttcatccggtggttcttgagacaaagcttggggacatcaagggcactgag
ttcttctttttgtcaaagaaaattcgaactttttttggtgtcccattcgcggagcctgca
gtcgaagattttcgttttcgaaaacctcgggaaaagaaacaatggagaggactctacgat
gcgacaaaaccggcgaacgcctgttttcagacaagggacaattataacacgagcttctgg
ggaagtgaaatgtggaacgcgaatactcaaattagtgaggactgtttatacctgaatatt
tgggctcccgcggatgcttacaatctcacagtgatggtgtggttttttggagggggcttc
tactctggaagcccgtcattgagtatctacgacgggaaagccttaacctccacccaaaac
gtgattgtcgtgaacatcaactaccgtctcggcccgttcggatttctctacctgggccac
ccagatgctcccggaaacatgggcctcctggaccagcaattggcgcttcattgggttcgt
caaaatattgtgtcatttggcggaaatccggacaaggtggccgtcttcggtcagtcagct
ggagccgcctcgatcgtcgctcatctgattgcaccaggctcccgaggattattcaaaaat
gccattcttcaatccggaagtctcgagaacacctgggcgattaattctccatttcgggca
aaacagaagtcggagaaacttttggaacttgtcgggtgcaataagactacggtggacacc
tcaatggcatgcctccgtctagtgtctccggaacaattgagcctgagcacttggaacatc
tctctgacttatctcgaatttccgtttgtcattgtctcgcgtgacaagcacttctttggc
catctagacgcgcatgcggcgttgcgtgaaggcgatttcaatagagatgtgaacctgatg
attgggatgaacaaggatgaaggcaactattggaatatctaccagctaccacagtttttc
gacaaggccgaccctccagagttgaacagaacggagttcgattttctcatagatcgaaca
ttctcaattcaacccgacatcattcgttcagcagccaagtacatttattcggatccgaat
tgcacagatcacggaagaaagactcgattctatgcgggccaaatgaaccaaatcgtcgga
gattactttttctcgtgtgattcattgtggctagctgatcagtttcgttcaattccgaga
gtaaaatcgagttcgccacagaggaaacccgggaaagtttttgtgtatcattttacacag
tcttcgagcgcaaacccttggccaaaatggactggcgcaatgcatggatacgaaatcgaa
tatgttttcggaattccgttaagttattcaaagaattataagcgaagagaacagatattc
tctcgaaaaattatgcagttttgggcgagttttgccaaaaatggaactccaaagctgcgt
gttctaaaaaatagcgaacattggccagagttcaacgagcagaatcattatcgttggatg
cagctccgcagtggctcaaatattcgaccgataaaaccgaaaaagcaagtggaatgccag
ttttggagaagagtcaaggatacagagtacacggcatacttgacacaagaatactcatca
agctccttgacaacatattcctattggctactactctatattccattattcattttccaa
attttctga

DBGET integrated database retrieval system