KEGG   Caenorhabditis elegans (nematode): CELE_Y49C4A.9Help
Entry
CELE_Y49C4A.9     CDS       T00019                                 

Gene name
cyp-33C11
Definition
Protein CYP-33C11
Orthology
K17955  
cytochrome P450, family 33
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Cytochrome P450 [BR:cel00199]
 Cytochrome P450, animal type
  CYP33 family
   CELE_Y49C4A.9 (cyp-33C11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(710643..710744,710795..710968,711011..711524,712181..712679,712724..712922))
Genome map
AA seq 495 aa AA seqDB search
MIAFSIFIAIFFWLAHCFYFKRRNLPPGPTPLPFLGNSLSMIWENPGYECFRRWTRIYGD
VFTFWLGDTPYVVISSLEKMKETFIKDGETYQDKIQFSFTEKFRGGRFGVIETTGHMWST
HRRFAISTFRDLGLGKNLMQEKILAEVEAVFQILDANLGAEQDVPEVIYNAVANVINQMI
FGYRFDESNQNEFEKLKDLIDIQEKSFASFKLCVQAFVPIMNKLLPGKSLEDLIAEKRHD
YYNFFYAQIQDHRAKINYQAEEYLDYAEAYLKEQKNQEQGGLGSDLFSDQQLANMCFDLW
FAGLTTTNTTINWTISYVLNHPEVQDKMQEELDKVVGSDRLVTISDKSSLPYMNAVINES
QRCVNLLPCNLFHATTRDTVINGNIIPKGTGVIAQISTVMLDEKIFPDPYKFQPERFIDE
NGALKKIEQLIPFSVGKRQCLGEGLARMELFLIVANLFNRYFITPSSAGPPSLERTEMVG
VFPRKFQAILTRRYE
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgatagctttttcaattttcatcgccatttttttctggctggctcattgtttctatttc
aaacgccgaaatctcccaccaggacctacaccacttcctttccttggcaattccctatca
atgatatgggagaacccgggctacgagtgttttagacggtggactagaatctatggggat
gtttttaccttttggctgggagacacaccctacgtcgttattagctctcttgaaaaaatg
aaggaaacttttatcaaagacggagagacttatcaggataaaatccaattttcattcacc
gagaaatttcgaggtggaagatttggagtaattgagacaactggacacatgtggagtact
catagaagatttgcaatttctacttttcgagatttggggctcggcaaaaatttgatgcaa
gaaaaaattctggccgaggttgaagcagtgtttcaaatattagatgcaaatctgggtgct
gagcaagatgtgccagaggtgatatataacgctgtggccaacgtcataaatcagatgata
tttggctatcggtttgatgaatcgaatcagaatgaatttgaaaagttgaaggatttgata
gatatccaagaaaaatcatttgcttccttcaaactttgcgttcaagcttttgtaccaatt
atgaataaattgctgccgggaaaatcattggaagatttgatcgctgaaaaaaggcacgac
tattacaactttttctacgcccaaatccaagaccaccgcgccaaaatcaattaccaagcc
gaagaatatcttgattacgctgaagcctacctcaaagaacagaaaaaccaggagcaaggt
ggtctcggctctgatttgttctccgaccagcagctggctaatatgtgctttgacttgtgg
tttgctgggctcaccacaactaacactacaataaattggacaataagctatgttttgaac
cacccggaagttcaagataagatgcaagaggagctggataaggtggtgggaagtgataga
ttggtgacaatatctgataaaagcagccttccgtacatgaatgcggtgatcaatgagtct
cagagatgtgtaaatttacttccctgcaatttgtttcacgcaactactagggatactgta
attaatggaaatataattccaaaaggaacaggtgttattgcccagattagtacagttatg
ctggatgagaagatcttccccgacccctataaattccaacctgaaagattcatagatgaa
aatggagcactgaaaaagatcgagcagctaatcccattttcagtcggaaaacggcagtgc
ctcggtgaagggctagctcggatggagcttttcctgattgtcgccaatctattcaatcga
tattttatcacaccatccagtgctggacctccatcattggagagaaccgaaatggtcggg
gtattcccaagaaaatttcaggcaattttgacgagaagatatgaataa

DBGET integrated database retrieval system