KEGG   Caenorhabditis elegans (nematode): CELE_Y49E10.4Help
Entry
CELE_Y49E10.4     CDS       T00019                                 

Gene name
Y49E10.4
Definition
Protein Y49E10.4
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CELE_Y49E10.4 (Y49E10.4)
Enzymes [BR:cel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CELE_Y49E10.4 (Y49E10.4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:complement(join(12379042..12379173,12379218..12379778,12379843..12380302,12380361..12380484,12380529..12380562))
Genome map
AA seq 436 aa AA seqDB search
MPRSLWILLVFAISGSSTFYTAKDSVFELTDSNFDAKVLKSDRIWIVEFYAPYCGHCKSL
VPEYKKAAKLLKGIAEIGAIDATVHQKIPLKYSIKGYPTIKIFGATEKSKPIDYNGPRTA
KGIADAVKKSIEKSLEQRLKGKSSEKSKKSDKKGKVVVLTDSNFDKLVLNSKEPWMVEFF
APWCGHCQKLEPEWKKAAEEMGGRVKFGALDATAHESIAQKFGIRGFPTIKFFAPGTSSA
SDAEDYQGGRTSTDLISYAESKYDDFGAAPEVVEGTGKAVVETVCKDKQLCIFTFLPSIF
DCQSKCRKQKIDMLNELATIFKKRSFGWVWMEGGAQENVQRAFEIGDYGFPVLIAMSPKK
MMYSTQIGQFSVDGIKEFLNAVNYGKGRVLEIKPTHLSNNFLKIVETQPWDGKDKELPVM
EDIDLSDVDMDEKTEL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgccgcggagtttatggattcttctagttttcgctatatccgggtcttcgacgttctac
actgccaaggacagcgtttttgagctcacggattcgaatttcgacgcaaaagtactgaaa
agtgatcgcatttggatagtggagttttatgcgccatactgtggccactgtaaatcgctt
gtcccagagtataaaaaagcagccaagctgctcaaaggaattgccgaaatcggagcaatc
gatgcgacagtccatcagaaaatcccattgaaatactccattaaaggatatccaacgatt
aaaattttcggagcgactgaaaaatccaagccgatcgattataatggtccaagaactgcg
aaaggaatagctgatgctgtcaaaaaatctattgaaaagagcttggagcaacgtttgaag
ggaaaatcatcagaaaaatccaagaaatcggataaaaagggaaaagtggtggttctgacc
gattcgaacttcgacaagctcgtcctgaacagcaaggagccatggatggtggaattcttt
gctccgtggtgtggacactgtcagaagcttgagccagagtggaaaaaggcggcagaggaa
atgggtggaagggttaagtttggagctctcgacgcaactgctcacgagtccatcgctcaa
aagttcggaatccgtggcttcccgacgatcaaattcttcgctccaggtacatcatcagct
tccgatgcagaggattatcaaggtggacgtacttcaaccgatctgatttcctacgcagaa
tccaagtatgatgactttggagcagctccagaagttgttgagggaaccggcaaagctgta
gttgaaaccgtgtgcaaggacaagcaattgtgcattttcacattccttccgagcattttc
gactgccaatccaagtgccgaaaacaaaaaatcgatatgctgaatgaattagcgacgatc
ttcaaaaaacgatcattcggatgggtttggatggaaggcggagcacaggaaaacgtccag
agagcatttgaaattggagattacggattcccggtgctcatcgcgatgagcccgaagaaa
atgatgtatagcacacaaattggacaattttctgttgatgggatcaaggaattcttgaat
gcggtcaattatggaaaaggaagagttctagaaattaagcccacgcatctttccaacaac
ttcctgaaaattgtcgaaacccagccatgggatggaaaggataaggaacttccggtaatg
gaggatatcgatttatcggatgtcgatatggatgagaagacggagctctaa

DBGET integrated database retrieval system