KEGG   Caenorhabditis elegans (nematode): CELE_Y49E10.4Help
Entry
CELE_Y49E10.4     CDS       T00019                                 

Definition
Protein Y49E10.4
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:cel04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:complement(join(12378941..12379072,12379117..12379677,12379742..12380201,12380260..12380383,12380428..12380461))
Genome map
AA seq 436 aa AA seqDB search
MPRSLWILLVFAISGSSTFYTAKDSVFELTDSNFDAKVLKSDRIWIVEFYAPYCGHCKSL
VPEYKKAAKLLKGIAEIGAIDATVHQKIPLKYSIKGYPTIKIFGATEKSKPIDYNGPRTA
KGIADAVKKSIEKSLEQRLKGKSSEKSKKSDKKGKVVVLTDSNFDKLVLNSKEPWMVEFF
APWCGHCQKLEPEWKKAAEEMGGRVKFGALDATAHESIAQKFGIRGFPTIKFFAPGTSSA
SDAEDYQGGRTSTDLISYAESKYDDFGAAPEVVEGTGKAVVETVCKDKQLCIFTFLPSIF
DCQSKCRKQKIDMLNELATIFKKRSFGWVWMEGGAQENVQRAFEIGDYGFPVLIAMSPKK
MMYSTQIGQFSVDGIKEFLNAVNYGKGRVLEIKPTHLSNNFLKIVETQPWDGKDKELPVM
EDIDLSDVDMDEKTEL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgccgcggagtttatggattcttctagttttcgctatatccgggtcttcgacgttctac
actgccaaggacagcgtttttgagctcacggattcgaatttcgacgcaaaagtactgaaa
agtgatcgcatttggatagtggagttttatgcgccatactgtggccactgtaaatcgctt
gtcccagagtataaaaaagcagccaagctgctcaaaggaattgccgaaatcggagcaatc
gatgcgacagtccatcagaaaatcccattgaaatactccattaaaggatatccaacgatt
aaaattttcggagcgactgaaaaatccaagccgatcgattataatggtccaagaactgcg
aaaggaatagctgatgctgtcaaaaaatctattgaaaagagcttggagcaacgtttgaag
ggaaaatcatcagaaaaatccaagaaatcggataaaaagggaaaagtggtggttctgacc
gattcgaacttcgacaagctcgtcctgaacagcaaggagccatggatggtggaattcttt
gctccgtggtgtggacactgtcagaagcttgagccagagtggaaaaaggcggcagaggaa
atgggtggaagggttaagtttggagctctcgacgcaactgctcacgagtccatcgctcaa
aagttcggaatccgtggcttcccgacgatcaaattcttcgctccaggtacatcatcagct
tccgatgcagaggattatcaaggtggacgtacttcaaccgatctgatttcctacgcagaa
tccaagtatgatgactttggagcagctccagaagttgttgagggaaccggcaaagctgta
gttgaaaccgtgtgcaaggacaagcaattgtgcattttcacattccttccgagcattttc
gactgccaatccaagtgccgaaaacaaaaaatcgatatgctgaatgaattagcgacgatc
ttcaaaaaacgatcattcggatgggtttggatggaaggcggagcacaggaaaacgtccag
agagcatttgaaattggagattacggattcccggtgctcatcgcgatgagcccgaagaaa
atgatgtatagcacacaaattggacaattttctgttgatgggatcaaggaattcttgaat
gcggtcaattatggaaaaggaagagttctagaaattaagcccacgcatctttccaacaac
ttcctgaaaattgtcgaaacccagccatgggatggaaaggataaggaacttccggtaatg
gaggatatcgatttatcggatgtcgatatggatgagaagacggagctctaa

DBGET integrated database retrieval system