KEGG   Caenorhabditis elegans (nematode): CELE_Y49F6B.1Help
Entry
CELE_Y49F6B.1     CDS       T00019                                 

Gene name
cyh-1
Definition
Protein CYH-1
Orthology
K06634  
cyclin H
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CELE_Y49F6B.1 (cyh-1)
  Replication and repair
   03420 Nucleotide excision repair
    CELE_Y49F6B.1 (cyh-1)
Transcription machinery [BR:cel03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CELE_Y49F6B.1 (cyh-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:join(3505019..3505090,3505535..3505653,3506074..3506182,3506633..3506715,3506766..3506864,3507428..3507609,3508476..3508596,3509236..3509449)
Genome map
AA seq 332 aa AA seqDB search
MYATSTQKREWTYTPEKLAAMRLEINIKFRQKYESVMQPDELELFVTPEEELRMQRSIED
AALKFADKFRPHIWPSVKWTALAFFKRAFLVWVPSDTSIRMVMMACFYLAMKIDEFYITI
EDFVKNMNVGEPRQNAERILKLEPELMKILDYNLTVHCPYRPYEGHLMDMKTRMLLLNFD
LESIRRDSMRFFQNALQTDVLLLYPPSQIALAAINFGLHAQGKSDEILREFLRKLIGIEE
DSWAHRDARPEDLEKLEKTVTRVNQIMREVDRNFVAVTEQERENHKSQLARIQALIPALD
ERRKEQWLAGGGVGLMPGELAEQPVDSDDEIN
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcgacgagcacacaaaaacgggaatggacgtatacaccggaaaagttggccgca
atgcgtttggagataaacataaaattccgtcaaaaatacgagtcagtaatgcagccggac
gagttggagctctttgtgacacctgaagaggagctcagaatgcaaagatcaattgaggat
gctgctttgaaattcgccgacaaattccgcccacacatatggccatcagtgaaatggaca
gccttggcgtttttcaagcgggcttttcttgtctgggtgccatcagacacgtcgattagg
atggtaatgatggcttgcttctacttggcaatgaaaatcgacgaattctacattacaatc
gaagatttcgtgaagaatatgaacgttggagaacctcgacaaaatgccgaacggattttg
aagctggagccggagcttatgaagattctcgactataatttgactgtacattgcccgtat
aggccatacgaaggccatctaatggatatgaagacccgaatgcttcttctaaatttcgat
ctcgaatcaatccgccgcgattctatgagattcttccagaatgcactacaaaccgacgtg
cttctcctctatccaccgtcacagattgcactggccgccattaatttcgggctccatgct
cagggcaaatccgacgagattctacgcgagtttcttcggaaacttatcggaatcgaagag
gactcgtgggctcatcgtgatgctcgtccagaggatttggaaaagctcgaaaagacggtt
acgagagtcaatcaaataatgcgagaagtcgatcgaaatttcgtagcagtgacagagcaa
gaacgggagaatcacaaaagccagctggcacggattcaagcattgattccagcacttgat
gaacgacgaaaagagcaatggttggctggtggaggtgttggattgatgcctggagagctc
gccgagcagccagttgattctgatgacgaaattaattga

DBGET integrated database retrieval system