KEGG   Caenorhabditis elegans (nematode): CELE_Y49F6B.1Help
Entry
CELE_Y49F6B.1     CDS       T00019                                 

Gene name
cyh-1
Definition
(RefSeq) CYclin H
  KO
K06634  cyclin H
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03022  Basal transcription factors
cel03420  Nucleotide excision repair
Module
cel_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CELE_Y49F6B.1 (cyh-1)
  Replication and repair
   03420 Nucleotide excision repair
    CELE_Y49F6B.1 (cyh-1)
Transcription machinery [BR:cel03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CELE_Y49F6B.1 (cyh-1)
DNA repair and recombination proteins [BR:cel03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     CELE_Y49F6B.1 (cyh-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N N2227 TFIIB DUF3251
Motif
Other DBs
NCBI-GeneID: 190078
NCBI-ProteinID: NP_494564
WormBase: WBGene00021714
Ensembl: WBGene00021714
UniProt: Q9N4U0
Position
II:join(3505019..3505090,3505535..3505653,3506074..3506182,3506633..3506715,3506766..3506864,3507428..3507609,3508476..3508596,3509236..3509449)
Genome map
AA seq 332 aa AA seqDB search
MYATSTQKREWTYTPEKLAAMRLEINIKFRQKYESVMQPDELELFVTPEEELRMQRSIED
AALKFADKFRPHIWPSVKWTALAFFKRAFLVWVPSDTSIRMVMMACFYLAMKIDEFYITI
EDFVKNMNVGEPRQNAERILKLEPELMKILDYNLTVHCPYRPYEGHLMDMKTRMLLLNFD
LESIRRDSMRFFQNALQTDVLLLYPPSQIALAAINFGLHAQGKSDEILREFLRKLIGIEE
DSWAHRDARPEDLEKLEKTVTRVNQIMREVDRNFVAVTEQERENHKSQLARIQALIPALD
ERRKEQWLAGGGVGLMPGELAEQPVDSDDEIN
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcgacgagcacacaaaaacgggaatggacgtatacaccggaaaagttggccgca
atgcgtttggagataaacataaaattccgtcaaaaatacgagtcagtaatgcagccggac
gagttggagctctttgtgacacctgaagaggagctcagaatgcaaagatcaattgaggat
gctgctttgaaattcgccgacaaattccgcccacacatatggccatcagtgaaatggaca
gccttggcgtttttcaagcgggcttttcttgtctgggtgccatcagacacgtcgattagg
atggtaatgatggcttgcttctacttggcaatgaaaatcgacgaattctacattacaatc
gaagatttcgtgaagaatatgaacgttggagaacctcgacaaaatgccgaacggattttg
aagctggagccggagcttatgaagattctcgactataatttgactgtacattgcccgtat
aggccatacgaaggccatctaatggatatgaagacccgaatgcttcttctaaatttcgat
ctcgaatcaatccgccgcgattctatgagattcttccagaatgcactacaaaccgacgtg
cttctcctctatccaccgtcacagattgcactggccgccattaatttcgggctccatgct
cagggcaaatccgacgagattctacgcgagtttcttcggaaacttatcggaatcgaagag
gactcgtgggctcatcgtgatgctcgtccagaggatttggaaaagctcgaaaagacggtt
acgagagtcaatcaaataatgcgagaagtcgatcgaaatttcgtagcagtgacagagcaa
gaacgggagaatcacaaaagccagctggcacggattcaagcattgattccagcacttgat
gaacgacgaaaagagcaatggttggctggtggaggtgttggattgatgcctggagagctc
gccgagcagccagttgattctgatgacgaaattaattga

DBGET integrated database retrieval system