KEGG   Caenorhabditis elegans (nematode): CELE_Y4C6B.6Help
Entry
CELE_Y4C6B.6      CDS       T00019                                 

Gene name
gba-4
Definition
Protein GBA-4
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CELE_Y4C6B.6 (gba-4)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CELE_Y4C6B.6 (gba-4)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    CELE_Y4C6B.6 (gba-4)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     CELE_Y4C6B.6 (gba-4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:complement(join(5344633..5344734,5344834..5345066,5345202..5345478,5346416..5346656,5346706..5347012,5347058..5347207,5347505..5347687,5350772..5350838))
Genome map
AA seq 519 aa AA seqDB search
MILNISVSLLIFLAFYGFSSDAKSLPCSEVKKEYGIVCRCNATYCDTIEPLGTVTSGKAV
VYTTSRNGKRMNRSELKHTTSSTAKTKVYVNTTQSFQPVMGFGAAFTDAAGINMKMLPQT
MQDQIIQQYFSDDGLGYVFGRVPMASTDFSTHEYSYDDVKFDFDLKNFNLTVEDLQYKIP
FIKKAMTASGGKLKLFATPWSSPGWMKTSGRMVGAGELLGDQNGKYYQTWAQYFVKFFEA
YHAQGIDFWSLTPQNEPTTGIDPLWKWQTLFFDASMERNFIKKLLGPALASSPVTKNLKI
MINDDQRINLPHWPNVILTDPTAAQYVHGIAIHWYEDFIDPATVLTETHEKFPDYFLLAT
EACAGYFPADGPKLGSWSRAEQYANDLIKDMGNWVGGWVDWNYILDLQGGPNLAKNFVDS
TIIVNATAQEYYKQPIWHVMAQFSKFVKPGAIRVGINIIEKSVDVEGLSFLNQDGTKTVV
LLNKNEVLSFDVAISDVSAPNVIYDLTIQPNSLITIVYK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgattttgaatatatccgtttctttgctaatatttctggcgttttatggattttcaagc
gatgcaaagtcccttccttgctccgaagtgaagaaagagtatggaatagtttgtcgttgc
aatgccacgtattgtgatacaattgaaccacttggaactgttacttctgggaaagcagtt
gtctatacaacatcaagaaatggaaaaagaatgaacagaagtgaattgaagcatacaact
tcttctacagccaaaacaaaagtatatgtgaacacaactcaaagttttcaaccggtaatg
ggatttggagctgcattcactgatgctgctggaattaatatgaagatgctgccacagaca
atgcaagatcaaattattcagcaatacttttccgatgatggtctcgggtatgtttttgga
cgagttccaatggcttcaactgacttttcaactcacgagtacagttatgacgacgttaaa
tttgattttgatctcaaaaatttcaatttaacagtggaagatctccagtataaaattcca
tttatcaagaaggcaatgacagcttctggagggaaattaaagctatttgcaactccatgg
agctccccaggatggatgaaaacttctggaagaatggttggtgccggagagctattggga
gatcagaatggaaaatactatcagacatgggcacagtactttgtaaaattcttcgaagcc
tatcacgctcaaggtattgacttttggtctttgacaccacaaaacgagccaacaactgga
attgatccactttggaaatggcaaacactctttttcgatgcatcaatggaacgaaatttt
ataaagaaacttttgggaccagcacttgcttcatcaccagtgactaagaatttgaagatt
atgattaatgatgatcagagaattaatttgccacactggccaaatgtaattttaacggat
ccaactgctgctcaatacgtccacggaattgcaattcattggtatgaagacttcattgac
ccagcaaccgtactcactgaaactcacgagaagttcccagactatttccttttggcaact
gaagcatgtgctggatacttcccagcagatggaccaaaattgggatcatggtctagagct
gaacaatatgcaaatgatttgattaaagatatgggaaattgggttggaggatgggttgat
tggaattatattcttgatttacaaggaggaccaaatcttgccaaaaactttgtcgattca
acaataatcgtgaatgcaactgctcaagagtactacaaacaaccaatttggcatgtaatg
gctcaattcagtaaatttgtgaaaccgggagctattcgtgttggaataaacattattgag
aaatcagttgatgttgagggtctttcatttttgaatcaagatggtaccaaaactgtggtt
ttattgaataaaaatgaggtactcagcttcgacgtggcaatcagtgacgtcagtgctcca
aatgtgatctatgatttgacaatccaaccgaattcactgattacaattgtttataaataa

DBGET integrated database retrieval system