KEGG   Caenorhabditis elegans (nematode): CELE_Y54E10BL.6Help
Entry
CELE_Y54E10BL.6   CDS       T00019                                 

Gene name
mek-2
Definition
(RefSeq) Dual specificity mitogen-activated protein kinase kinase mek-2
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04012  ErbB signaling pathway
cel04068  FoxO signaling pathway
cel04140  Autophagy - animal
cel04150  mTOR signaling pathway
Module
cel_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:cel00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CELE_Y54E10BL.6 (mek-2)
   04012 ErbB signaling pathway
    CELE_Y54E10BL.6 (mek-2)
   04068 FoxO signaling pathway
    CELE_Y54E10BL.6 (mek-2)
   04150 mTOR signaling pathway
    CELE_Y54E10BL.6 (mek-2)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    CELE_Y54E10BL.6 (mek-2)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CELE_Y54E10BL.6 (mek-2)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: STE group
  STE7 family
   CELE_Y54E10BL.6 (mek-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Seadorna_VP7 Haspin_kinase Choline_kinase
Motif
Other DBs
NCBI-GeneID: 171872
NCBI-ProteinID: NP_491087
WormBase: WBGene00003186
Ensembl: WBGene00003186
UniProt: Q10664
Position
I:complement(join(3006029..3006203,3007653..3007933,3008734..3008858,3008909..3009005,3012844..3013062,3013118..3013297,3013359..3013445))
Genome map
AA seq 387 aa AA seqDB search
MSSGKRRNPLGLSLPPTVNEQSESGEATAEEATATVPLEEQLKKLGLTEPQTQRLSEFLQ
VKEGIKELSEDMLQTEGELGHGNGGVVNKCVHRKTGVIMARKLVHLEIKPSVRQQIVKEL
AVLHKCNSPFIVGFYGAFVDNNDISICMEYMDGLSLDIVLKKVGRLPEKFVGRISVAVVR
GLTYLKDEIKILHRDVKPSNMLVNSNGEIKLCDFGVSGMLIDSMANSFVGTRSYMAPERL
TGSHYTISSDIWSFGLSLVELLIGRYPVPAPSQAEYATMFNVAENEIELADSLEEPNYHP
PSNPASMAIFEMLDYIVNGPPPTLPKRFFTDEVIGFVSKCLRKLPSERATLKSLTADVFF
TQYADHDDQGEFAVFVKGTINLPKLNP
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcggaaaacggcgtaatccgttgggactcagtctaccaccgacagtaaatgaa
caaagtgaaagtggcgaggcgacggcggaagaagccaccgcgacagtcccactagaagaa
cagctgaaaaagctcgggctcacggagccacaaactcaacggctcagcgaattcttgcag
gtcaaggagggcatcaaggagttgagtgaggatatgctacagactgaaggagaacttggc
catggaaatggaggagttgttaataagtgtgttcatcgaaaaaccggtgtaattatggct
cggaagcttgtacacctcgagatcaagccgtcagtccgacaacagatcgtcaaagagctc
gccgtacttcacaagtgcaatagtccattcattgttggattctacggggcttttgtggac
aataacgatatatcaatttgtatggagtatatggatgggctttcacttgatatagttttg
aaaaaggttggccgcctcccggaaaagtttgtcggacgaatctcggttgcagttgtccgt
ggattgacgtacttgaaagatgaaattaagattttgcatagagatgttaaaccatcgaat
atgcttgtcaatagtaacggagaaattaaattatgcgattttggagtctctggaatgttg
attgattcgatggccaactcatttgtcggaacgaggagttatatggcgcccgaacgactc
acaggatcccactatacaatttcatcggatatctggtcatttggattatcacttgtcgaa
cttcttattggacgatatccagtgcctgcaccgtctcaagcagaatatgctacaatgttt
aatgtggctgaaaatgagattgaactggctgatagtcttgaagagcccaactatcatccg
ccgagcaatccggcgtcaatggctatttttgaaatgcttgattatattgttaatggacct
ccgccaacacttccgaagagattctttactgacgaagtgattggatttgtgtcgaaatgc
cttcgaaaacttccaagtgaacgagcaaccctaaaatctctcaccgcagacgtcttcttc
acacaatatgcagatcacgatgatcagggagaattcgcggtttttgtgaagggaacgatt
aatctaccaaagttgaatccataa

DBGET integrated database retrieval system