KEGG   Caenorhabditis elegans (nematode): CELE_Y54E10BL.6Help
Entry
CELE_Y54E10BL.6   CDS       T00019                                 

Gene name
mek-2
Definition
Protein MEK-2
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:cel04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:cel04012]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:cel04068]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:cel04320]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:complement(join(3006031..3006205,3007655..3007935,3008736..3008860,3008911..3009007,3012846..3013064,3013120..3013299,3013361..3013447))
Genome map
AA seq 387 aa AA seqDB search
MSSGKRRNPLGLSLPPTVNEQSESGEATAEEATATVPLEEQLKKLGLTEPQTQRLSEFLQ
VKEGIKELSEDMLQTEGELGHGNGGVVNKCVHRKTGVIMARKLVHLEIKPSVRQQIVKEL
AVLHKCNSPFIVGFYGAFVDNNDISICMEYMDGLSLDIVLKKVGRLPEKFVGRISVAVVR
GLTYLKDEIKILHRDVKPSNMLVNSNGEIKLCDFGVSGMLIDSMANSFVGTRSYMAPERL
TGSHYTISSDIWSFGLSLVELLIGRYPVPAPSQAEYATMFNVAENEIELADSLEEPNYHP
PSNPASMAIFEMLDYIVNGPPPTLPKRFFTDEVIGFVSKCLRKLPSERATLKSLTADVFF
TQYADHDDQGEFAVFVKGTINLPKLNP
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcggaaaacggcgtaatccgttgggactcagtctaccaccgacagtaaatgaa
caaagtgaaagtggcgaggcgacggcggaagaagccaccgcgacagtcccactagaagaa
cagctgaaaaagctcgggctcacggagccacaaactcaacggctcagcgaattcttgcag
gtcaaggagggcatcaaggagttgagtgaggatatgctacagactgaaggagaacttggc
catggaaatggaggagttgttaataagtgtgttcatcgaaaaaccggtgtaattatggct
cggaagcttgtacacctcgagatcaagccgtcagtccgacaacagatcgtcaaagagctc
gccgtacttcacaagtgcaatagtccattcattgttggattctacggggcttttgtggac
aataacgatatatcaatttgtatggagtatatggatgggctttcacttgatatagttttg
aaaaaggttggccgcctcccggaaaagtttgtcggacgaatctcggttgcagttgtccgt
ggattgacgtacttgaaagatgaaattaagattttgcatagagatgttaaaccatcgaat
atgcttgtcaatagtaacggagaaattaaattatgcgattttggagtctctggaatgttg
attgattcgatggccaactcatttgtcggaacgaggagttatatggcgcccgaacgactc
acaggatcccactatacaatttcatcggatatctggtcatttggattatcacttgtcgaa
cttcttattggacgatatccagtgcctgcaccgtctcaagcagaatatgctacaatgttt
aatgtggctgaaaatgagattgaactggctgatagtcttgaagagcccaactatcatccg
ccgagcaatccggcgtcaatggctatttttgaaatgcttgattatattgttaatggacct
ccgccaacacttccgaagagattctttactgacgaagtgattggatttgtgtcgaaatgc
cttcgaaaacttccaagtgaacgagcaaccctaaaatctctcaccgcagacgtcttcttc
acacaatatgcagatcacgatgatcagggagaattcgcggtttttgtgaagggaacgatt
aatctaccaaagttgaatccataa

DBGET integrated database retrieval system