KEGG   Caenorhabditis elegans (nematode): CELE_Y54E10BL.6Help
Entry
CELE_Y54E10BL.6   CDS       T00019                                 

Gene name
mek-2
Definition
Protein MEK-2
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:cel00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CELE_Y54E10BL.6 (mek-2)
   04012 ErbB signaling pathway
    CELE_Y54E10BL.6 (mek-2)
   04068 FoxO signaling pathway
    CELE_Y54E10BL.6 (mek-2)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    CELE_Y54E10BL.6 (mek-2)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CELE_Y54E10BL.6 (mek-2)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   CELE_Y54E10BL.6 (mek-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:complement(join(3006029..3006203,3007653..3007933,3008734..3008858,3008909..3009005,3012844..3013062,3013118..3013297,3013359..3013445))
Genome map
AA seq 387 aa AA seqDB search
MSSGKRRNPLGLSLPPTVNEQSESGEATAEEATATVPLEEQLKKLGLTEPQTQRLSEFLQ
VKEGIKELSEDMLQTEGELGHGNGGVVNKCVHRKTGVIMARKLVHLEIKPSVRQQIVKEL
AVLHKCNSPFIVGFYGAFVDNNDISICMEYMDGLSLDIVLKKVGRLPEKFVGRISVAVVR
GLTYLKDEIKILHRDVKPSNMLVNSNGEIKLCDFGVSGMLIDSMANSFVGTRSYMAPERL
TGSHYTISSDIWSFGLSLVELLIGRYPVPAPSQAEYATMFNVAENEIELADSLEEPNYHP
PSNPASMAIFEMLDYIVNGPPPTLPKRFFTDEVIGFVSKCLRKLPSERATLKSLTADVFF
TQYADHDDQGEFAVFVKGTINLPKLNP
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcggaaaacggcgtaatccgttgggactcagtctaccaccgacagtaaatgaa
caaagtgaaagtggcgaggcgacggcggaagaagccaccgcgacagtcccactagaagaa
cagctgaaaaagctcgggctcacggagccacaaactcaacggctcagcgaattcttgcag
gtcaaggagggcatcaaggagttgagtgaggatatgctacagactgaaggagaacttggc
catggaaatggaggagttgttaataagtgtgttcatcgaaaaaccggtgtaattatggct
cggaagcttgtacacctcgagatcaagccgtcagtccgacaacagatcgtcaaagagctc
gccgtacttcacaagtgcaatagtccattcattgttggattctacggggcttttgtggac
aataacgatatatcaatttgtatggagtatatggatgggctttcacttgatatagttttg
aaaaaggttggccgcctcccggaaaagtttgtcggacgaatctcggttgcagttgtccgt
ggattgacgtacttgaaagatgaaattaagattttgcatagagatgttaaaccatcgaat
atgcttgtcaatagtaacggagaaattaaattatgcgattttggagtctctggaatgttg
attgattcgatggccaactcatttgtcggaacgaggagttatatggcgcccgaacgactc
acaggatcccactatacaatttcatcggatatctggtcatttggattatcacttgtcgaa
cttcttattggacgatatccagtgcctgcaccgtctcaagcagaatatgctacaatgttt
aatgtggctgaaaatgagattgaactggctgatagtcttgaagagcccaactatcatccg
ccgagcaatccggcgtcaatggctatttttgaaatgcttgattatattgttaatggacct
ccgccaacacttccgaagagattctttactgacgaagtgattggatttgtgtcgaaatgc
cttcgaaaacttccaagtgaacgagcaaccctaaaatctctcaccgcagacgtcttcttc
acacaatatgcagatcacgatgatcagggagaattcgcggtttttgtgaagggaacgatt
aatctaccaaagttgaatccataa

DBGET integrated database retrieval system