KEGG   Caenorhabditis elegans (nematode): CELE_Y54E2A.11Help
Entry
CELE_Y54E2A.11    CDS       T00019                                 

Gene name
eif-3.B
Definition
Protein EIF-3.B, isoform A
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:cel03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:join(14795353..14795434,14795504..14795697,14795743..14796075,14796129..14796836,14796907..14797767)
Genome map
AA seq 725 aa AA seqDB search
MVEIDFNKENEEDFSDPPGFVDDVTDDVLVPDVLHKKPTIDEFEDNCVFIAGIPVVGADR
LGKLQSVLKKVLERLDPAVKLYIPPSPEGGCLGVLLTEWADQRSAQFAVKSLNGYAFDKN
HTFTARSFKDMKQLEAPSDHWTTPEKQAYNDVGDLWWWLQNERCRDQFAISHDKLGVPTV
GVFTNMKGNDPELAGDADKAERANWTETVFTWSPHGSYLSTIHKQGIILWGGKDYARAHR
FAHTNVQYIDFSPWETYLVTYAAPEESNSWGDCEKDSLRIWDVRTGELKKAFSTFELTGR
TQLPTWPFFRWSFDEKYFACLKAPEKDKLEREQKINGISIFESEKFELYEGRPVNIENIK
QFEWSPTSTVLAYYSECTDAVPAEFGLLQVPSMQRLRSARVHNVADAQMFWQKSGKRLAF
YTMRFKKKEYRETGEVKYVGGCQYHVDIFEIDKKDVSLMNLPLSEPFIHFDWDPEGDKFC
VLVGNTAKATPQVYKIEANSHAPKLVSKLDAGVHFNEVQFAPKGGWLAVLAKVSAGGNVY
FIDTSLSEAKRTNVIEHPLFNKGYWDPTGRYFVTCSTLGGRAGADLGYRIFTFQGRELCR
KNLDRLAQFKWRPRPPVKLSEQKQREIKKNLKKTAAKFIKQDDDEKCRASQEVVEKRRKI
MAAFDIIRSRNREQLDATRDERISLRNGVDTEAQLDEDEFVDEEITIALSTSKTQAPLTE
EEMRD
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaaattgactttaataaagagaacgaagaagatttttcggatccgccaggattt
gttgacgacgtcaccgatgatgttctcgttcctgacgttctccacaagaaaccaactatc
gatgaatttgaagacaattgcgtcttcatcgcgggaatcccagttgttggagctgaccgt
cttggaaaactccaaagtgtactgaagaaggttctggagaggttggatcctgcagtgaag
ctctacattccgccaagtccagaaggaggttgcttgggagttctgctcaccgagtgggcc
gatcaacgatccgctcagttcgccgtgaaaagtttgaatggatatgctttcgataagaat
cacacattcaccgcccgttctttcaaggatatgaagcaactcgaagctccttccgatcac
tggacaactccagagaagcaggcttataatgacgttggagatctctggtggtggcttcaa
aacgagcgttgccgtgatcagttcgcaatttcccacgataaacttggagttccaactgtc
ggagtgttcaccaatatgaagggaaatgatccagagcttgcaggagatgccgataaggct
gaaagagctaactggaccgaaaccgtcttcacttggtcaccacacggctcctacctttcc
acgatccataagcaaggaatcatactttggggaggcaaagactacgctcgtgcccaccgt
ttcgctcataccaacgttcaatacattgatttctcgccgtgggagacctaccttgttacc
tacgccgctccggaagagtcgaacagctggggagactgtgagaaggatagtttgagaatt
tgggacgtccgaaccggagaattgaagaaggccttttccactttcgagctcaccggaaga
actcagctcccaacctggccattcttcagatggtcattcgatgagaagtacttcgcgtgc
ctcaaggctccagaaaaggataagcttgagcgtgagcagaagatcaacggaatttcgatc
ttcgaatccgagaagttcgagctctatgaaggccgtcccgtgaatatcgagaatatcaag
caattcgagtggtcgccaacatccacagtcctcgcctactattcagagtgcactgacgcc
gttccagccgagtttggactcttgcaagttccatcaatgcagagacttcgttcggctcgc
gttcacaatgtcgccgacgctcagatgttctggcagaagagcggaaagcgattggccttc
tacacgatgagattcaagaagaaggagtacagagagaccggagaagtcaaatatgtggga
ggatgccaataccacgtggacatcttcgagattgacaagaaggacgtttcccttatgaat
ctcccactttcggagccattcatccatttcgattgggatccagaaggcgataagttctgt
gtgctcgtgggaaacaccgctaaggccactccacaagtctacaagatcgaggctaacagc
cacgcaccgaagcttgtgagcaagttggacgctggagttcacttcaatgaggttcaattc
gcgccgaaaggaggatggcttgcagttctcgccaaggtgtcagctggaggaaacgtctat
ttcattgatacttctttgtcggaggccaagagaactaatgttatagaacatccactcttc
aataagggatattgggatccaactggaagatactttgtgacatgctcaacgttgggagga
agagccggagccgatttgggttaccgaatcttcacattccagggaagagaactgtgcaga
aagaatctcgaccggctcgcccaattcaagtggagaccacggccgccggtgaagttgagc
gaacagaagcagcgtgagatcaagaagaacttgaagaagaccgccgccaagttcatcaag
caggatgacgacgaaaagtgcagagccagtcaggaggttgttgagaagcgacgcaagatc
atggctgccttcgatattattcgaagccggaatcgcgagcaactcgacgccacccgtgac
gagagaatctctcttcgaaacggcgtggacacagaagcccaactcgacgaggacgaattt
gtggatgaggagattaccattgcgctgagcacaagcaaaacacaagcccctctgacggag
gaggagatgagagactaa

DBGET integrated database retrieval system