KEGG   Caenorhabditis elegans (nematode): CELE_Y54E2A.11Help
Entry
CELE_Y54E2A.11    CDS       T00019                                 

Gene name
eif-3.B
Definition
(RefSeq) EIF-3.B, isoform A
  KO
K03253  
translation initiation factor 3 subunit B
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CELE_Y54E2A.11 (eif-3.B)
Messenger RNA biogenesis [BR:cel03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     CELE_Y54E2A.11 (eif-3.B)
Translation factors [BR:cel03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    CELE_Y54E2A.11 (eif-3.B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:join(14795429..14795510,14795580..14795773,14795819..14796151,14796205..14796912,14796983..14797843)
Genome map
AA seq 725 aa AA seqDB search
MVEIDFNKENEEDFSDPPGFVDDVTDDVLVPDVLHKKPTIDEFEDNCVFIAGIPVVGADR
LGKLQSVLKKVLERLDPAVKLYIPPSPEGGCLGVLLTEWADQRSAQFAVKSLNGYAFDKN
HTFTARSFKDMKQLEAPSDHWTTPEKQAYNDVGDLWWWLQNERCRDQFAISHDKLGVPTV
GVFTNMKGNDPELAGDADKAERANWTETVFTWSPHGSYLSTIHKQGIILWGGKDYARAHR
FAHTNVQYIDFSPCETYLVTYAAPEESNSWGDCEKDSLRIWDVRTGELKKAFSTFELTGR
TQLPTWPFFRWSFDEKYFACLKAPEKDKLEREQKINGISIFESEKFELYEGRPVNIENIK
QFEWSPTSTVLAYYSECTDAVPAEFGLLQVPSMQRLRSARVHNVADAQMFWQKSGKRLAF
YTMRFKKKEYRETGEVKYVGGCQYHVDIFEIDKKDVSLMNLPLSEPFIHFDWDPEGDKFC
VLVGNTAKATPQVYKIEANSHAPKLVSKLDAGVHFNEVQFAPKGGWLAVLAKVSAGGNVY
FIDTSLSEAKRTNVIEHPLFNKGYWDPTGRYFVTCSTLGGRAGADLGYRIFTFQGRELCR
KNLDRLAQFKWRPRPPVKLSEQKQREIKKNLKKTAAKFIKQDDDEKCRASQEVVEKRRKI
MAAFDIIRSRNREQLDATRDERISLRNGVDTEAQLDEDEFVDEEITIALSTSKTQAPLTE
EEMRD
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaaattgactttaataaagagaacgaagaagatttttcggatccgccaggattt
gttgacgacgtcaccgatgatgttctcgttcctgacgttctccacaagaaaccaactatc
gatgaatttgaagacaattgcgtcttcatcgcgggaatcccagttgttggagctgaccgt
cttggaaaactccaaagtgtactgaagaaggttctggagaggttggatcctgcagtgaag
ctctacattccgccaagtccagaaggaggttgcttgggagttctgctcaccgagtgggcc
gatcaacgatccgctcagttcgccgtgaaaagtttgaatggatatgctttcgataagaat
cacacattcaccgcccgttctttcaaggatatgaagcaactcgaagctccttccgatcac
tggacaactccagagaagcaggcttataatgacgttggagatctctggtggtggcttcaa
aacgagcgttgccgtgatcagttcgcaatttcccacgataaacttggagttccaactgtc
ggagtgttcaccaatatgaagggaaatgatccagagcttgcaggagatgccgataaggct
gaaagagctaactggaccgaaaccgtcttcacttggtcaccacacggctcctacctttcc
acgatccataagcaaggaatcatactttggggaggcaaagactacgctcgtgcccaccgt
ttcgctcataccaacgttcaatacattgatttctcgccgtgtgagacctaccttgttacc
tacgccgctccggaagagtcgaacagctggggagactgtgagaaggatagtttgagaatt
tgggacgtccgaaccggagaattgaagaaggccttttccactttcgagctcaccggaaga
actcagctcccaacctggccattcttcagatggtcattcgatgagaagtacttcgcgtgc
ctcaaggctccagaaaaggataagcttgagcgtgagcagaagatcaacggaatttcgatc
ttcgaatccgagaagttcgagctctatgaaggccgtcccgtgaatatcgagaatatcaag
caattcgagtggtcgccaacatccacagtcctcgcctactattcagagtgcactgacgcc
gttccagccgagtttggactcttgcaagttccatcaatgcagagacttcgttcggctcgc
gttcacaatgtcgccgacgctcagatgttctggcagaagagcggaaagcgattggccttc
tacacgatgagattcaagaagaaggagtacagagagaccggagaagtcaaatatgtggga
ggatgccaataccacgtggacatcttcgagattgacaagaaggacgtttcccttatgaat
ctcccactttcggagccattcatccatttcgattgggatccagaaggcgataagttctgt
gtgctcgtgggaaacaccgctaaggccactccacaagtctacaagatcgaggctaacagc
cacgcaccgaagcttgtgagcaagttggacgctggagttcacttcaatgaggttcaattc
gcgccgaaaggaggatggcttgcagttctcgccaaggtgtcagctggaggaaacgtctat
ttcattgatacttctttgtcggaggccaagagaactaatgttatagaacatccactcttc
aataagggatattgggatccaactggaagatactttgtgacatgctcaacgttgggagga
agagccggagccgatttgggttaccgaatcttcacattccagggaagagaactgtgcaga
aagaatctcgaccggctcgcccaattcaagtggagaccacggccgccggtgaagttgagc
gaacagaagcagcgtgagatcaagaagaacttgaagaagaccgccgccaagttcatcaag
caggatgacgacgaaaagtgcagagccagtcaggaggttgttgagaagcgacgcaagatc
atggctgccttcgatattattcgaagccggaatcgcgagcaactcgacgccacccgtgac
gagagaatctctcttcgaaacggcgtggacacagaagcccaactcgacgaggacgaattt
gtggatgaggagattaccattgcgctgagcacaagcaaaacacaagcccctctgacggag
gaggagatgagagactaa

DBGET integrated database retrieval system