KEGG   Caenorhabditis elegans (nematode): CELE_Y57A10A.30Help
Entry
CELE_Y57A10A.30   CDS       T00019                                 

Gene name
ife-5
Definition
Protein IFE-5
Orthology
K03259  
translation initiation factor 4E
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CELE_Y57A10A.30 (ife-5)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    CELE_Y57A10A.30 (ife-5)
Translation factors [BR:cel03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    CELE_Y57A10A.30 (ife-5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:join(12283299..12283753,12283807..12283957)
Genome map
AA seq 201 aa AA seqDB search
MTELTTPIYPLQRNWSWWFLNDDRNASWQDRLKKVYTFNTVPEFWAFYEAILPPSGLNDL
CDYNVFRDDIQPKWEAPENWDGGRWLIIINKGKTPEVLDAVWLEILLALIGEQFGKDMES
ICGLVCNVRGQGSKISVWTKNCNDDDTNMRIGVVLKEKLMAAASKAHSKPLFDVIHYQTH
RNCVKKTTSALKYKFSLKSIV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgactgaattgacgacacccatctatcctctgcagcggaactggtcgtggtggttcttg
aacgatgatcgcaacgcgtcttggcaggatcgtctgaaaaaggtgtacaccttcaacacc
gtaccggaattctgggctttctacgaagctatccttccaccaagtggcctcaacgatctg
tgcgattacaacgttttccgtgacgatattcagccgaaatgggaggctccggaaaactgg
gatggtggacgttggctcattatcattaacaagggaaagactcccgaagtgttggacgcc
gtttggctggaaattctcttggctttgatcggcgagcaattcggaaaggatatggagtcg
atttgtgggctggtgtgtaacgtcagaggacagggatcgaagatcagcgtctggactaaa
aactgtaatgatgatgatactaatatgaggattggagttgtgctgaaggagaagctgatg
gccgcggcatccaaggcacactcgaagccactgttcgacgtgattcactaccaaacacat
aggaattgcgtgaagaagaccacctcggctctgaaatacaaattttcattgaaatccatc
gtctaa

DBGET integrated database retrieval system