KEGG   Caenorhabditis elegans (nematode): CELE_Y62E10A.2Help
Entry
CELE_Y62E10A.2    CDS       T00019                                 

Gene name
Y62E10A.2
Definition
Protein Y62E10A.2
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CELE_Y62E10A.2 (Y62E10A.2)
   03008 Ribosome biogenesis in eukaryotes
    CELE_Y62E10A.2 (Y62E10A.2)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     CELE_Y62E10A.2 (Y62E10A.2)
Ribosome biogenesis [BR:cel03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     CELE_Y62E10A.2 (Y62E10A.2)
Transfer RNA biogenesis [BR:cel03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    CELE_Y62E10A.2 (Y62E10A.2)
Mitochondrial biogenesis [BR:cel03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    CELE_Y62E10A.2 (Y62E10A.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(13371078..13371190,13371250..13371529)
Genome map
AA seq 130 aa AA seqDB search
MAIRMTPSSKRFDEKTNEMRRRPPVKPSSNPNHIYITRKTNVESQSKSTEEMLNNAFDEV
FIHGMGASINKALVFAMEVERRFGGSVKSDIQTSTVQCTDDIVSLLDLDQSETRHRSVSA
VHVHLYRVAS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggctatccgcatgactccatcatcgaaacgattcgatgaaaaaacaaacgaaatgagg
cgccgtccgcctgtaaaaccaagcagtaatcctaatcatatttatatcacaagaaaaacc
aacgtcgaatcacaatcaaaatccaccgaggagatgttgaataacgcattcgatgaagtt
ttcatccatggaatgggagcatctatcaataaagctctagtttttgcgatggaagttgag
agaagattcggtggaagtgtcaagtctgatattcaaacgtctactgtacaatgtacagat
gatattgtatcacttctggaccttgatcaaagcgagacacgtcatcgttctgtttctgcc
gtgcatgttcatctttatcgtgttgcctcgtaa

DBGET integrated database retrieval system