KEGG   Caenorhabditis elegans (nematode): CELE_Y62E10A.2Help
Entry
CELE_Y62E10A.2    CDS       T00019                                 

Gene name
Y62E10A.2
Definition
(RefSeq) Uncharacterized protein
  KO
K14527  ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03008  Ribosome biogenesis in eukaryotes
cel03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CELE_Y62E10A.2 (Y62E10A.2)
   03008 Ribosome biogenesis in eukaryotes
    CELE_Y62E10A.2 (Y62E10A.2)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     CELE_Y62E10A.2 (Y62E10A.2)
Ribosome biogenesis [BR:cel03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     CELE_Y62E10A.2 (Y62E10A.2)
Transfer RNA biogenesis [BR:cel03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    CELE_Y62E10A.2 (Y62E10A.2)
Mitochondrial biogenesis [BR:cel03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    CELE_Y62E10A.2 (Y62E10A.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1242
Motif
Other DBs
NCBI-GeneID: 178298
NCBI-ProteinID: NP_001348764
WormBase: WBGene00013373
Ensembl: WBGene00013373
Position
IV:join(<13370709..13370732,13370792..13370901,13370971..13371073)
Genome map
AA seq 78 aa AA seqDB search
LVAETAKLSAIFNFQSLISVILLLICTCAYIRAFAPRIIDRNKEGLLGVFWKCARIGERL
SPWVSISCFCMAFVVLFL
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
ttggttgcagaaacagcaaaactgtcggcaatcttcaacttccaaagtcttatctcagtt
atccttcttctcatttgcacgtgtgcctacatcagagcctttgcaccgagaataatcgat
agaaacaaggaaggtctcctcggcgttttctggaagtgtgctcgaatcggtgaacgtctc
agtccgtgggtatcgatcagttgcttttgcatggcatttgttgtgctgttcctttaa

DBGET integrated database retrieval system