KEGG   Caenorhabditis elegans (nematode): CELE_Y62E10A.2Help
Entry
CELE_Y62E10A.2    CDS       T00019                                 

Gene name
Y62E10A.2
Definition
Protein Y62E10A.2
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:cel03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:cel03008]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(13371054..13371166,13371226..13371505)
Genome map
AA seq 130 aa AA seqDB search
MAIRMTPSSKRFDEKTNEMRRRPPVKPSSNPNHIYITRKTNVESQSKSTEEMLNNAFDEV
FIHGMGASINKALVFAMEVERRFGGSVKSDIQTSTVQCTDDIVSLLDLDQSETRHRSVSA
VHVHLYRVAS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggctatccgcatgactccatcatcgaaacgattcgatgaaaaaacaaacgaaatgagg
cgccgtccgcctgtaaaaccaagcagtaatcctaatcatatttatatcacaagaaaaacc
aacgtcgaatcacaatcaaaatccaccgaggagatgttgaataacgcattcgatgaagtt
ttcatccatggaatgggagcatctatcaataaagctctagtttttgcgatggaagttgag
agaagattcggtggaagtgtcaagtctgatattcaaacgtctactgtacaatgtacagat
gatattgtatcacttctggaccttgatcaaagcgagacacgtcatcgttctgtttctgcc
gtgcatgttcatctttatcgtgttgcctcgtaa

DBGET integrated database retrieval system