KEGG   Caenorhabditis elegans (nematode): CELE_Y67D2.2Help
Entry
CELE_Y67D2.2      CDS       T00019                                 

Gene name
Y67D2.2
Definition
Protein Y67D2.2
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CELE_Y67D2.2 (Y67D2.2)
Peptidases [BR:cel01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CELE_Y67D2.2 (Y67D2.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(1558882..1558908,1558959..1559043,1559110..1559250,1560215..1560539,1561328..1561427,1563295..1563627,1564978..1565132,1565393..1565555,1569756..1569851)
Genome map
AA seq 474 aa AA seqDB search
MDLRGYSPQTIVAGTLIGGTLAAAVTYAFLTSRNGEEASSSRLVPGLANQGNTCYMNALL
QGLASCPSFVGWLKSLKPQDIGIQGGFVDHLSNLLHLLNEPTGSTLTAQSIVESLKAHGW
SITVGVEHDLYELFNVFVTTWEDELKSSRRILMNQSIENCHSSSSEDDEDVVVESTSLRG
SPSIIRKLMSFQRCASMARIDASLRSPCVGLTATEYRCCNTNCGYRTVKYESFTVLTLAI
PNSQMGTSTNTESLLRRFFCSEIIRDAICDKCRASDRKQQGFLKKHGIVKLPQTLMIRIE
RVGMLPNGSMKLSEHVHFGECLSLQDVCFRKNPKINQKSYEESSLHWQLPDGTSRVVGGA
EETRSRRSPIHPSQAAIFGDLASNYALIDGGSFVAERREAQKYAYQLRAVSEHRGGPYSG
HFVTYRRASAPNHHTWYYTSDAQVTRVPYSHVAACQSYMLFYERVKPHRLYERM
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggatttacgtggttattcgcctcaaacaatcgtcgctgggacacttattggtggaaca
cttgccgctgcagtgacctatgcgtttttgacaagcagaaatggtgaagaagcgtccagc
agcagactggtgcccggattagcgaatcagggcaatacatgctatatgaatgcacttttg
caaggattggcgagctgcccgtcatttgtcgggtggttaaagtctctgaagcctcaggat
attggaattcagggcggcttcgtagatcacctctccaatttgcttcatttgctcaatgag
ccaacaggctccaccctcacagctcaatcaatagtcgaaagtttaaaggcgcatggttgg
agtattactgtaggcgttgaacatgatctctacgaacttttcaatgtatttgtaacaact
tgggaggatgaattgaagagttcccggcgtattttaatgaatcaatcgattgaaaattgt
catagtagtagtagtgaagatgatgaagatgtggtggtggaatcgacgagtttaagagga
tccccgtcaattatcagaaaattgatgagttttcagagatgcgcctcaatggctcgaatt
gacgcgagcctccgctcaccgtgtgtcggcctaactgccacagaatacagatgttgcaac
acaaattgtggatataggacagtaaaatacgaatccttcacagttctgactctggcaatc
ccaaattctcaaatgggaacctccacaaacacagaatccctgctccgccgtttcttttgc
tcggagatcattcgcgacgcgatttgtgacaaatgtcgggcttctgaccggaaacagcag
ggttttctgaaaaaacacggaattgtgaagctcccgcagaccctaatgattcgaatcgag
cgagttggaatgctgccaaatggaagtatgaaattatcggaacacgtgcatttcggcgaa
tgtctatcgctgcaggacgtttgttttcggaaaaatccaaaaattaatcagaaatcctac
gaagaatcatctttgcattggcaattaccagatggaacatcccgtgttgtcggtggagct
gaagaaacaagatccagaagatcaccaattcatccatctcaggcggcgatttttggagat
ttagcatcaaattatgcacttattgacggtggctcattcgttgccgagcgacgtgaagct
caaaagtacgcatatcaactgagagcagtcagtgagcacagaggaggtccatattctgga
cattttgtcacttatcgaagagcaagtgctccaaatcatcatacatggtattataccagt
gatgcacaggtaacccgtgtaccgtactcccacgtggcagcctgtcaaagttatatgcta
ttctacgaacgtgtcaaacctcatcgactctacgaaaggatgtaa

DBGET integrated database retrieval system