KEGG   Caenorhabditis elegans (nematode): CELE_Y69A2AR.5Help
Entry
CELE_Y69A2AR.5    CDS       T00019                                 

Gene name
daao-1
Definition
Protein DAAO-1
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CELE_Y69A2AR.5 (daao-1)
   00330 Arginine and proline metabolism
    CELE_Y69A2AR.5 (daao-1)
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    CELE_Y69A2AR.5 (daao-1)
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    CELE_Y69A2AR.5 (daao-1)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    CELE_Y69A2AR.5 (daao-1)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     CELE_Y69A2AR.5 (daao-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(2614202..2614285,2614375..2614475,2614882..2614948,2614993..2615114,2615564..2615845,2616721..2617033)
Genome map
AA seq 322 aa AA seqDB search
MPKIAVLGAGINGIASALAIQERLPNCEVTIIAEKFSPNTTSDVAAGLIEPFLCDDDVDR
IINWTSATISRIHEYQADGNPGAEEQSGYWLQSVKSEPKWLKLMKNVHILTDAEMKQVAR
RPEHKFGIFYTTWYLEPTPYIKWCTDKFLKNGGKFKKQKIENIDDVARSYDVTVNCTGLG
SRALIGDKEVYPTRGQILKVSCPRVKHFFIDDKYYALLNDSTITLGGTFEAHQWDLTINS
ELSQKILKENIHNIPSLRTAQILSSHVDMRPSRGTVRLQAELGRSLVHNYGHGGSGITLH
WGCALECAEIVENVLKMKKSKL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaattgctgtactaggcgcaggaattaacggtatagcatcggctcttgcaatt
caggaacgactgccaaattgtgaggtgacaataattgctgaaaaattttctccgaacact
acaagtgacgtggcagccgggctcattgagccatttctttgtgacgatgatgtggataga
attataaactggacatctgccacaatttcccgaatccatgagtaccaagctgacggaaat
cctggcgcggaggaacaatcaggatattggttacaaagtgtaaaaagtgagccaaaatgg
ttaaaactgatgaaaaatgtgcacattttgacggacgccgagatgaagcaggtggcacgg
aggcccgagcacaaattcggaatattctacacgacatggtacctggaaccaactccatat
atcaagtggtgcaccgataaatttttgaaaaatggcgggaaattcaaaaaacaaaaaatc
gagaatattgatgacgtggcaagaagctatgacgtcacagtgaactgcaccgggttgggg
tcccgagcactgattggtgataaggaagtctatccgacgcgtggtcagattttgaaggtc
tcgtgtccacgtgtcaaacattttttcatcgatgacaagtattacgcgctgttgaacgac
tccacaataaccctcggcggtaccttcgaagcccaccagtgggacctgacaataaattcc
gaactttcccaaaaaatcctcaaagaaaacattcacaacattccatcattacgtaccgct
caaattttgtccagtcacgttgatatgcggccctcgcggggtactgtaagactgcaagct
gagctcgggaggagtttggtgcacaattatgggcacggtggatccggaattacacttcat
tggggatgtgctttggaatgtgctgaaattgtggaaaatgtgctgaaaatgaaaaagtcg
aagttgtga

DBGET integrated database retrieval system