KEGG   Caenorhabditis elegans (nematode): CELE_Y69A2AR.5Help
Entry
CELE_Y69A2AR.5    CDS       T00019                                 

Gene name
daao-1
Definition
Protein DAAO-1
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cel00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cel00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:cel00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis
Cellular Processes; Transport and catabolism; Peroxisome [PATH:cel04146]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(2614200..2614283,2614373..2614473,2614880..2614946,2614991..2615112,2615562..2615843,2616719..2617031)
Genome map
AA seq 322 aa AA seqDB search
MPKIAVLGAGINGIASALAIQERLPNCEVTIIAEKFSPNTTSDVAAGLIEPFLCDDDVDR
IINWTSATISRIHEYQADGNPGAEEQSGYWLQSVKSEPKWLKLMKNVHILTDAEMKQVAR
RPEHKFGIFYTTWYLEPTPYIKWCTDKFLKNGGKFKKQKIENIDDVARSYDVTVNCTGLG
SRALIGDKEVYPTRGQILKVSCPRVKHFFIDDKYYALLNDSTITLGGTFEAHQWDLTINS
ELSQKILKENIHNIPSLRTAQILSSHVDMRPSRGTVRLQAELGRSLVHNYGHGGSGITLH
WGCALECAEIVENVLKMKKSKL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaattgctgtactaggcgcaggaattaacggtatagcatcggctcttgcaatt
caggaacgactgccaaattgtgaggtgacaataattgctgaaaaattttctccgaacact
acaagtgacgtggcagccgggctcattgagccatttctttgtgacgatgatgtggataga
attataaactggacatctgccacaatttcccgaatccatgagtaccaagctgacggaaat
cctggcgcggaggaacaatcaggatattggttacaaagtgtaaaaagtgagccaaaatgg
ttaaaactgatgaaaaatgtgcacattttgacggacgccgagatgaagcaggtggcacgg
aggcccgagcacaaattcggaatattctacacgacatggtacctggaaccaactccatat
atcaagtggtgcaccgataaatttttgaaaaatggcgggaaattcaaaaaacaaaaaatc
gagaatattgatgacgtggcaagaagctatgacgtcacagtgaactgcaccgggttgggg
tcccgagcactgattggtgataaggaagtctatccgacgcgtggtcagattttgaaggtc
tcgtgtccacgtgtcaaacattttttcatcgatgacaagtattacgcgctgttgaacgac
tccacaataaccctcggcggtaccttcgaagcccaccagtgggacctgacaataaattcc
gaactttcccaaaaaatcctcaaagaaaacattcacaacattccatcattacgtaccgct
caaattttgtccagtcacgttgatatgcggccctcgcggggtactgtaagactgcaagct
gagctcgggaggagtttggtgcacaattatgggcacggtggatccggaattacacttcat
tggggatgtgctttggaatgtgctgaaattgtggaaaatgtgctgaaaatgaaaaagtcg
aagttgtga

DBGET integrated database retrieval system