KEGG   Caenorhabditis elegans (nematode): CELE_Y70D2A.2Help
Entry
CELE_Y70D2A.2     CDS       T00019                                 

Gene name
hex-5
Definition
Protein HEX-5
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CELE_Y70D2A.2 (hex-5)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CELE_Y70D2A.2 (hex-5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:complement(join(14902093..14902159,14903037..14903252,14903296..14903470,14903514..14903608,14903655..14903790,14903845..14904031,14904115..14904306,14904353..14904524,14904820..14904905,14904950..14905035,14905135..14905261))
Genome map
AA seq 512 aa AA seqDB search
MCNIFQIVWKPMLLRRTICILACIVQFATCGYQRSIVHFDMKGAPPKVAYFKQLLTTISG
LGATGVLLEWEDMFPYQGGLSRVVNKNAYTEEEVISVLEHAQQLQLEVIPLVQTLAHMEW
ILKTEEYSVLREDERYPMVACIGNPESLDIILDSVNQLMRIHSNFNTGYVHIGADEAFQV
GICDADREILPVKYDNNKLRMIFDHLRMVSLNITEEYPSTKVLMWYDELKSAPLELIKEY
NLDNLVIPVVWKYTANLDNDLPSEMWKNMSYSFKEVWGGSAFKGADGASRYWNRLKPYIL
NNKEWYLQNEKYKPQFTTFDSIIITGWQRYDHFASLCELWPTSMVSLALNLIVLTKFHID
KESAEQVIQALNCPQTTTLDQLVAGSDRCRFPGYRVRDSIRDYVQLKTFFENSTWVHNRE
NGWLQSSHMRISASNPYYIDAIGKAYERTLKKLDTVSNSLSTSFSEVFYPDVIEEFKTDY
FQPFYEDLQKRKESVDNIDTKRFYVPRPWFRR
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaacatttttcagattgtttggaagcctatgctacttcgaaggacaatctgtatt
ttagcgtgtattgtacagttcgcaacatgcggatatcaaaggtctatagttcattttgat
atgaaaggtgctcctccaaaagtcgcctacttcaagcagcttctcaccacaattagtggg
ttaggtgccacaggagtgttactagagtgggaagacatgttcccatatcaaggaggtctt
tctagagttgttaataaaaatgcttataccgaagaggaagtgattagtgtattggaacat
gcacaacagttacaacttgaagtgatcccgttggttcaaactcttgcccatatggaatgg
atactgaaaactgaagagtactcagtgctgcgagaagacgagcgttatccaatggtagct
tgtattgggaacccggaaagtttggatatcattttagactcggttaaccaactaatgaga
atacattccaacttcaatactggatatgtgcatattggcgcagatgaagcgtttcaagtg
ggaatatgtgatgcggatcgcgagattttgccggtcaaatatgacaacaataagttgcgt
atgatcttcgaccacttgagaatggtgtcgcttaacattacggaagaatatccatccaca
aaggtgttaatgtggtacgacgaactgaaaagtgcgcccttagaacttatcaaagaatac
aaccttgacaatcttgtgataccggtcgtatggaaatataccgctaacttggacaatgat
ttaccttcagagatgtggaaaaatatgtcctactcgtttaaggaagtatggggtggcagt
gcttttaaaggcgcggatggtgctagtcggtattggaatcgcttgaaaccatatatactc
aacaataaagaatggtatcttcaaaatgaaaaatataaaccacagtttacgacctttgac
tctatcatcatcactggttggcaaagatatgatcactttgcatcactctgtgaactttgg
ccaacttcaatggtatcactggcattgaacctgattgttttaacaaagtttcatatagac
aaggagtctgccgaacaagtaatacaggcattaaattgtccacaaaccaccacacttgat
cagcttgtggctgggtcggatcggtgccgatttcccgggtatcgagtacgggattcaata
agagattatgtgcagttaaagacattttttgaaaactccacgtgggttcacaatagggaa
aacggctggttgcaatcgtcacacatgagaatatcagctagtaacccatattacatcgac
gcaattgggaaggcctacgaaagaacgctgaaaaagttggatacggtttcgaatagttta
agcacttcgtttagtgaagtgttttacccggatgtgattgaagaattcaaaacagattat
ttccagccgttctatgaggacctacaaaaaagaaaagagtcagtcgacaacattgataca
aaacgattttacgtgccgcgtccgtggttccggaggtga

DBGET integrated database retrieval system