KEGG   Caenorhabditis elegans (nematode): CELE_Y71H10A.1Help
Entry
CELE_Y71H10A.1    CDS       T00019                                 

Gene name
pfk-1.1
Definition
(RefSeq) PFK-1.1, isoform A
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CELE_Y71H10A.1 (pfk-1.1)
   01230 Biosynthesis of amino acids
    CELE_Y71H10A.1 (pfk-1.1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CELE_Y71H10A.1 (pfk-1.1)
   00030 Pentose phosphate pathway
    CELE_Y71H10A.1 (pfk-1.1)
   00051 Fructose and mannose metabolism
    CELE_Y71H10A.1 (pfk-1.1)
   00052 Galactose metabolism
    CELE_Y71H10A.1 (pfk-1.1)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CELE_Y71H10A.1 (pfk-1.1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CELE_Y71H10A.1 (pfk-1.1)
Protein phosphatases and associated proteins [BR:cel01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CELE_Y71H10A.1 (pfk-1.1)
Messenger RNA biogenesis [BR:cel03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CELE_Y71H10A.1 (pfk-1.1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EnsemblGenomes-Gn: 
EnsemblGenomes-Tr: 
UniProt: 
Position
X:join(2940890..2941064,2941205..2941419,2941487..2941804,2941854..2942222,2942970..2943600,2943651..2944272,2945101..2945215)
Genome map
AA seq 814 aa AA seqDB search
MDADASTITPEELDFIRQRALRRFDSIVPTAGREGTEIASDIFKGRTLAIYTSGGDSQGM
NSAVRSITRMAIYCGCKVYLIYEGYEGMIEGGDFIKEATWNTVSDIIQQGGTIIGSARSS
EFRTREGRLKAATNLINRGIGRLVCIGGDGSLTGANTFRLEWTDLVQELVKNQRVTAAAA
KKIPYIQIVGLVGSIDNDFCGTDMTIGTDSALQRIISSIDAVVATAQSHQRAFVIEVMGR
HCGYLALVAALASEADFCFIPEWPAPENWRDVLCDKLSQMRSEGQRLNIIIVAEGAIDRD
GKAITAEDVKTAVKEKLKYDTRVTILGHVQRGGAPSAFDRLLGCRMGAEAVFALMEMTEE
SEPCVISIDGNVMVRVPLLKCVERTQMVQKAMADKDWTTAVMLRGRSFQRNLETYKLLTK
MRTVEKDNLSEGHKFNVAVINVGAPAGGMNAAVRSYVRMALYHQCTVYGIEDSFEGLANG
SFKQFKWSDVTNWAMNGGSFLGTQKSLPTEKTMPQLAAQLKKHNIQALLLVGGFEAYHST
IILAENREKYPEFCIPMCVIPCTISNNVPGTMVSLGSDTAINEICQMIDKIKQSATGTKR
RVFIVETMGGYCGYLATLSALSSGADNAYIFEEPFTVQDLSDDVDVILSKMEVGAKRYLV
VRNEWADKNLTTDFVQNLFDSEGKKNFTTRVNVLGHVQQGGSPTPFDRNMGTKLAARALE
FLLIQLKENLTADNKVIAKSAHTATLLGLKGRKVVFTPVQDLKKETDFEHRLPSEQWWMA
LRPLLRVLARHRSTVESSAILESVEEESADSHMF
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atggacgcggacgcatcaacaatcacgccagaagagctcgactttatccgtcagcgagct
ttgcgccgcttcgactcaatcgtcccaactgctggaagagaaggaactgagattgcgtcg
gatattttcaagggacgtactctcgcgatttacacgtccggaggagactctcaaggtatg
aacagcgctgttcgaagtatcacaagaatggctatatactgtggatgtaaagtgtatttg
atctacgaaggatacgaaggaatgattgaaggtggagatttcatcaaggaagccacgtgg
aacaccgtttccgatattattcagcaaggaggaactatcattggttccgcaagatcttcc
gaattcagaactcgtgaagggcgtctcaaggcagccaccaacctgattaatcgtggaatt
ggtcgtcttgtatgcattggtggagatggatctctcactggagccaacactttccgtttg
gagtggaccgatcttgtgcaagaacttgtgaaaaatcaacgagtcactgcggcggctgcg
aaaaagattccttacattcaaattgtcggacttgtcggatccatcgacaacgatttttgt
ggaaccgacatgacgattggaaccgactcggcacttcaaagaattatcagttctattgat
gctgtagtcgcaactgcacaaagtcatcaaagggcttttgttattgaggtcatgggtcgc
cattgtggatatctggctctagttgctgctctagcttccgaagccgacttctgcttcatt
cctgaatggccggcaccggaaaattggcgtgacgtcttgtgcgacaaactttctcaaatg
agatcagagggtcaacgtcttaacatcattattgtcgccgagggagctattgatcgtgat
ggaaaggctatcaccgccgaggatgtgaagactgctgtcaaggagaagctgaaatacgat
acacgcgttacaattcttggacatgttcaacgcggaggtgctccatctgcttttgatcga
cttcttggatgtagaatgggagcagaagcagtttttgctctcatggagatgactgaggaa
tcagaaccttgtgttatctcaattgacggaaatgttatggtccgtgtgccacttctcaag
tgtgtcgaacgaactcaaatggtacagaaggcaatggcggataaggactggaccacggct
gtgatgcttcgtggacgcagtttccagagaaatcttgaaacgtacaagttgctgactaag
atgagaaccgtcgaaaaggacaatctttcggaaggacacaaattcaatgttgctgtaatc
aacgttggcgctccagccggtggaatgaatgcagccgtccgctcttatgttcgaatggct
ctctaccatcagtgtaccgtgtacggtattgaagacagttttgagggacttgccaatggg
tcattcaaacagttcaagtggtccgatgttactaactgggcaatgaacggaggatcgttc
cttggcacacagaaaagtcttccaactgagaaaactatgcctcaacttgctgctcaactg
aagaagcacaatattcaagcgttattgcttgttggaggatttgaagcgtatcacagcaca
ataattcttgctgaaaatcgcgaaaagtatcccgagttttgcattccaatgtgtgtcatc
ccatgcaccatctcgaacaatgttccaggaactatggtgtctctcggatccgataccgcg
atcaatgagatttgccagatgatcgacaaaatcaagcaatctgccactggtaccaagaga
agagttttcattgtcgaaacaatgggaggatactgtggttaccttgccactctttctgcg
ttgagctccggtgcggataatgcgtacatttttgaagagccattcaccgttcaagacctc
tccgatgatgttgatgtgattctctcaaagatggaagttggagcgaaacgctacttggtt
gtcagaaatgagtgggccgacaagaacctcaccacagattttgtgcagaatctttttgat
tctgaaggaaagaagaacttcaccacaagagtcaatgttctcggacatgttcaacagggt
ggatctccaacgccgttcgacagaaatatgggaaccaagctggccgctcgtgctttggag
tttttgctcattcagctcaaggaaaatttgacggccgataacaaggtgatcgccaagtca
gcccatactgcgacgcttcttggactcaaaggacgaaaggtggtgttcacgccggtgcaa
gatctcaagaaggagaccgattttgagcatcgtcttccatcagagcaatggtggatggct
ctgcgtccacttctccgtgttctcgctcgtcatcgttcgaccgttgaaagttctgcaatt
ttggaatctgttgaagaagaaagcgccgactcacacatgttctga

DBGET integrated database retrieval system