KEGG   Caenorhabditis elegans (nematode): CELE_Y71H2AL.1Help
Entry
CELE_Y71H2AL.1    CDS       T00019                                 

Gene name
pbo-1
Definition
Protein PBO-1
Orthology
K17610  
calcineurin B homologous protein 1
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Protein phosphatases and associated proteins [BR:cel01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     CELE_Y71H2AL.1 (pbo-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:complement(join(2681554..2681607,2681654..2681767,2681998..2682068,2682113..2682228,2685078..2685145,2685601..2685704,2686397..2686460))
Genome map
AA seq 196 aa AA seqDB search
MGQNSSQIPEHELEHLSIESGLSRGGILKLYGRFISLATHRDKTTNEYFLTKGDFQSIAE
LKQNPLGDRIIDAFFADAEVLERRKVYFKDFVKVLSHFRPINKNKPHPWNSREAKLRFAF
TMYDLNKSGTITKDEFQDILAMMIGVGVPKDQVNSIADRTMREADRDGDGFITFQEFCNA
MEKTDIEQKMSFRFLT
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgggccaaaattcgtctcaaattccagagcacgagctcgaacacttgagcattgagagt
ggattgtctcgcggtggaattctgaaactgtacggaagattcatctcgctggcaactcac
agggataagactacaaatgagtatttcctcacaaaaggagattttcagtcaatcgccgag
ctgaaacaaaatcctctcggagaccggatcatcgacgcattcttcgccgacgcagaagtc
ttggaacgccgcaaagtgtacttcaaagattttgtaaaagttctgagccatttccgcccg
atcaacaaaaacaagccgcatccatggaatagcagagaggcaaaattgagattcgcgttt
acgatgtacgatttgaataaaagtggaaccattacaaaggacgagtttcaggatattctt
gcgatgatgatcggagtaggtgttccaaaagatcaagtaaactcaattgcggacagaaca
atgcgtgaagctgatagagacggagacggattcatcacttttcaagaattctgcaacgca
atggaaaagacagatatcgagcagaagatgtccttccgttttttgacataa

DBGET integrated database retrieval system