KEGG   Caenorhabditis elegans (nematode): CELE_Y71H2AM.5Help
Entry
CELE_Y71H2AM.5    CDS       T00019                                 

Gene name
cox-6B
Definition
(RefSeq) Cytochrome OXidase assembly protein
  KO
K02267  
cytochrome c oxidase subunit 6b
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Oxidative phosphorylation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    CELE_Y71H2AM.5 (cox-6B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
WormBase: 
Ensembl: 
UniProt: 
Position
III:join(2786204..2786260,2786308..2786427,2786491..2786679)
Genome map
AA seq 121 aa AA seqDB search
MPVEVEVPPTTYERLQQYKEKFSDALRHPDSPDWYKKETHESVKKDLLWAAPYDARFPQV
RKQRQCFAYYVDFHRCNELMGQDYKPCKFFQNVYKDFCPGFWTERWDELLSEGRFPAKFD
R
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcgaagttgaggttcccccaaccacttacgagagactccagcaatacaaggag
aagttctccgatgctctccgtcatccagactcgccagactggtacaagaaggagacccac
gagtctgtgaagaaggatcttctctgggctgctccatacgacgccagattcccacaggtc
cgtaagcaacgtcaatgcttcgcctactacgtcgatttccatcgttgcaatgagctcatg
ggacaggactacaagccgtgcaagttcttccaaaatgtctacaaggacttctgccccgga
ttctggaccgagagatgggacgagcttctttccgagggacgtttcccagctaaattcgat
cgctaa

DBGET integrated database retrieval system