KEGG   Caenorhabditis elegans (nematode): CELE_Y71H2AR.3Help
Entry
CELE_Y71H2AR.3    CDS       T00019                                 

Gene name
josd-1
Definition
Protein JOSD-1
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CELE_Y71H2AR.3 (josd-1)
Peptidases [BR:cel01002]
 Cysteine Peptidases
  Family C86
   CELE_Y71H2AR.3 (josd-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(2836639..2836796,2837604..2837673,2837740..2837882,2838139..2838289)
Genome map
AA seq 173 aa AA seqDB search
MTSSPEIYHEKQRLQYCLIHTVNNILQKSEFDPTKMDEICYAFNESKWFNPHRSWIGTGN
YDANILMAALQKHDLKVMWFDKRVSVEKINMENVKAVVFNIPSRTLLTLYRGRHWFAVIQ
KNGIFYNVDSKIKQPQVIEDIRKFVKIHVDSPDSEVMLVVENSVDEATVVDKN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcatcaccagaaatttatcacgaaaagcaacgtcttcaatactgccttatccat
acggttaacaatattctacaaaaatccgaatttgatccgacaaaaatggacgaaatttgc
tatgcgtttaatgagagtaaatggtttaatccacatagatcctggataggaaccggaaat
tacgatgcgaatatcctgatggcggcgcttcaaaaacacgatttaaaggtaatgtggttc
gacaagcgtgtttcagtcgaaaaaatcaatatggaaaatgtgaaagcagtggtttttaat
attccatcacggaccctcctcacattgtacaggggacgacattggtttgcagttattcag
aaaaatggaatattctacaacgtcgactcaaaaatcaaacagccgcaggtgatcgaagat
attcggaagtttgtgaaaatccacgtggattcgcctgattcggaagtgatgctggtcgtg
gaaaacagtgtcgacgaggcgacggttgtcgataaaaattaa

DBGET integrated database retrieval system