KEGG   Caenorhabditis elegans (nematode): CELE_Y71H2AR.3Help
Entry
CELE_Y71H2AR.3    CDS       T00019                                 

Gene name
Y71H2AR.3
Definition
Protein Y71H2AR.3
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(2836631..2836788,2837596..2837665,2837732..2837874,2838131..2838281)
Genome map
AA seq 173 aa AA seqDB search
MTSSPEIYHEKQRLQYCLIHTVNNILQKSEFDPTKMDEICYAFNESKWFNPHRSWIGTGN
YDANILMAALQKHDLKVMWFDKRVSVEKINMENVKAVVFNIPSRTLLTLYRGRHWFAVIQ
KNGIFYNVDSKIKQPQVIEDIRKFVKIHVDSPDSEVMLVVENSVDEATVVDKN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcatcaccagaaatttatcacgaaaagcaacgtcttcaatactgccttatccat
acggttaacaatattctacaaaaatccgaatttgatccgacaaaaatggacgaaatttgc
tatgcgtttaatgagagtaaatggtttaatccacatagatcctggataggaaccggaaat
tacgatgcgaatatcctgatggcggcgcttcaaaaacacgatttaaaggtaatgtggttc
gacaagcgtgtttcagtcgaaaaaatcaatatggaaaatgtgaaagcagtggtttttaat
attccatcacggaccctcctcacattgtacaggggacgacattggtttgcagttattcag
aaaaatggaatattctacaacgtcgactcaaaaatcaaacagccgcaggtgatcgaagat
attcggaagtttgtgaaaatccacgtggattcgcctgattcggaagtgatgctggtcgtg
gaaaacagtgtcgacgaggcgacggttgtcgataaaaattaa

DBGET integrated database retrieval system