KEGG   Caenorhabditis elegans (nematode): CELE_Y71H2B.10Help
Entry
CELE_Y71H2B.10    CDS       T00019                                 

Gene name
apb-1
Definition
Protein APB-1, isoform B
Orthology
K11825  
AP-2 complex subunit beta-1
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cel00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CELE_Y71H2B.10 (apb-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:complement(join(2584197..2584268,2584486..2584640,2585323..2585497,2596680..2596921,2596977..2597013))
Genome map
AA seq 226 aa AA seqDB search
MTDSKYFTTTKKGEIFELKNELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQT
DNVELKKLVYLYLMNYAKSQPDLAIMAVNTFVKVAIKNDINAFYFATTVPLLAYFREDGQ
MEKREFLEEWKSIPEQNEQQFTLQNTHNMNADAICTKLQQNNIHTVARRQVDNQQLLYHS
VKYTNNLNVLSELKVNSQTTSITLSLKSKNLMAIANINEVFQALLN
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactccaaatatttcaccaccacaaagaaaggagaaatattcgaactgaaaaat
gagctcaactctgacaaaaaggagaagaaaaaagaggctgtgaagaaggttatcgccagt
atgacagtcggaaaagacgtcagcgctctatttcccgatgtggtgaattgtatgcagacg
gataatgttgaattgaagaaattagtctatctgtatttgatgaattacgcgaaatcgcag
cctgatctcgcgattatggcggttaacacgtttgttaaggttgccattaaaaacgacatc
aacgcgttctactttgccaccacagtcccattgttggcctatttccgagaagatggacaa
atggaaaaacgtgaattccttgaggaatggaagagtattccagagcaaaatgagcaacag
tttaccctacagaatacgcataatatgaatgctgacgcaatttgcacaaaactacaacaa
aacaacattcatacggtggcacggcgacaagttgacaatcaacaacttttgtatcattct
gtcaagtatacgaacaatttgaatgtgctctcagagctcaaagtcaactcacagaccacg
tcgattacgctctccctaaaatcgaagaatctgatggcgattgcaaacatcaatgaagta
ttccaagcgcttctcaactga

DBGET integrated database retrieval system