KEGG   Caenorhabditis elegans (nematode): CELE_Y73F8A.24Help
Entry
CELE_Y73F8A.24    CDS       T00019                                 

Gene name
Y73F8A.24
Definition
(RefSeq) Y73F8A.24, isoform A
  KO
K03144  
transcription initiation factor TFIIH subunit 4
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CELE_Y73F8A.24 (Y73F8A.24)
  Replication and repair
   03420 Nucleotide excision repair
    CELE_Y73F8A.24 (Y73F8A.24)
Transcription machinery [BR:cel03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CELE_Y73F8A.24 (Y73F8A.24)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EnsemblGenomes-Gn: 
EnsemblGenomes-Tr: 
UniProt: 
Position
IV:complement(join(15445472..15445741,15446550..15446706,15447146..15447340,15449094..15449196,15449267..15449526,15451079..15451221,15452390..15452498,15452560..15452635,15453055..15453187))
Genome map
AA seq 481 aa AA seqDB search
MSSDQPAAAPHLTGTSSKNSCLFLDFLITIPPKTRQRLLQKPSCAFFIYRMLPPIAQQTT
IQLIWKGSFPTASDVEETKEIEDQVKLLKDLGLVHRQTTDGKLNIDTDYKRSYMYAAMLG
AAQISSLVLEPNEGNRRGKDVEKKAVERWDCILRYLALPSEENTQAVSETTRNLFKKANF
TSGGDTQIEITTFGFQFLLLSPVKQMWTYVIEYLKLEMSQGQDIVEVIEPLIQIVLLANR
GFKAERECYQIDANWTEPQNELLNHLRELGVIFIRKRKDGVFFLTQLLTHLATNETIDDV
SAEKVSNGKVIVETNFRVYAYTSSLLQLAIIALFTEMTYRFQDMSVGMITRESVRGALQH
GITAAQIISFLRANAHPQCIATSGPVNCLPITVADQIRLWEDERRRMNLKDAYIYSHFES
EDEFHGVCEYARQQNILLWSDNQQKLVIVNEDGHELVRQWYKREKSKTGAGGEASSSTSS
A
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccgatcagccggcggcggcaccacatctaacgggtacttcatcgaaaaattcg
tgtctttttctcgattttctcatcacaattccgccaaaaacgcgacaacggctccttcag
aagccgtcatgtgcgtttttcatctaccgtatgcttcctccaattgcccaacaaaccaca
attcaattgatttggaaaggaagttttccaacagcttcagacgttgaggagacgaaagaa
attgaggatcaagtgaaacttttgaaagatttaggtttagtacatcgtcagacgacggat
gggaagcttaatattgatacagactacaagcgatcctacatgtatgcggcaatgctcggc
gccgcgcaaatttcgagtttagttttggaaccgaatgagggaaatcgtagaggaaaagat
gttgaaaagaaggctgtggagagatgggattgtattttaagatacctagctcttccatcc
gaagaaaacactcaagccgtctccgaaaccaccagaaatttattcaaaaaagccaatttc
acaagtggtggtgatacacaaatcgaaatcaccacttttggttttcaatttctcctttta
agccctgtcaaacaaatgtggacatatgttatcgaatatttaaaactagaaatgagccaa
ggacaggatattgtcgaagttattgagccattgatacaaattgtgctcttggcgaataga
ggattcaaagccgaacgggaatgttatcaaatcgatgcgaactggacggagccacagaat
gagctgctcaatcatttgagagagctcggcgttatttttattagaaaacgaaaagacgga
gtattctttctaactcaactgctcacccatctggccaccaacgaaacaatcgatgacgtg
tcagcggagaaggtctcgaacggaaaagttattgtggagacaaatttccgagtgtacgcg
tacacttcgtcactgctacaactcgcgattatcgccctgttcactgaaatgacttataga
ttccaagacatgtctgtcggaatgattacacgtgaatccgtacgaggagccctgcaacac
ggaatcaccgccgctcagatcatctcgttcctccgtgccaacgcccacccacaatgcatc
gccacgtcggggcctgtgaattgtctgccgattacggtagccgatcaaattcgcctgtgg
gaagacgaacgtcgtcgtatgaacctgaaagacgcctacatttactctcatttcgagtcg
gaagacgaatttcatggtgtctgtgagtatgctcgacagcagaacatcctcctgtggtct
gataatcagcagaagcttgtgattgttaatgaggatggacatgagctcgtcaggcagtgg
tacaaacgcgagaagagcaagactggagcaggaggagaagccagcagcagcacatcgagc
gcctga

DBGET integrated database retrieval system