KEGG   Caenorhabditis elegans (nematode): CELE_Y97E10AL.2Help
Entry
CELE_Y97E10AL.2   CDS       T00019                                 

Gene name
abhd-12
Definition
(RefSeq) ABHydrolase Domain containing homolog
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     CELE_Y97E10AL.2 (abhd-12)
Peptidases [BR:cel01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   CELE_Y97E10AL.2 (abhd-12)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   CELE_Y97E10AL.2 (abhd-12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Abhydrolase_2 DLH DUF900 Peptidase_S15 PAF-AH_p_II LIDHydrolase Say1_Mug180 VirJ
Motif
Other DBs
NCBI-GeneID: 179172
NCBI-ProteinID: NP_505054
WormBase: WBGene00022393
Ensembl: WBGene00022393
UniProt: Q965S2
Position
V:join(7984143..7984159,7984228..7984349,7984406..7984607,7984654..7984896,7985405..7985620,7985670..7985907)
Genome map
AA seq 345 aa AA seqDB search
MLGYFIVLIQPLLLCITILVLSIVIFLPILVYFLPRYTQFIFFLNFRRLPNTDYNDLASN
NVKSIGRSLHLPGKSGRIGVWHILPNKLSLEWRTEGKHPTERDFDDMMRDSENQIIFYAH
GNSFDRTFYHRVEMYNLLSDCNYHVVCFDYRGYGDSEGTPTEKGIVEDTKTVYEWLKENC
GKTPVIVWGHSMGTGVSCKLVQDLSREQQPPCGLILESPFNNLKDAVTNHPIFTVFSWMN
DFMVDHIIIRPLNSVGLTMRSDKRIRLVSCPIIILHAEDDKILPVKLGRALYEAAKDAER
DIKIREFSSDYGLGHKFICRYPELPEIIEEFVGSVTPPSTLIASS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgctaggctattttattgtacttattcaaccgctactactctgtatcacaattctagtc
ctctcaattgtcatcttccttccaatactggtatattttcttccacgctacacacagttc
atcttctttctcaatttccgacgtctgccgaacaccgattacaatgatttggcgtcgaac
aacgttaaatcaatcggaagatctcttcatttgcctggaaaaagtggaaggattggtgtt
tggcacattctgcccaacaaattgagtttagaatggagaacagaaggaaaacatccgaca
gagagagattttgacgatatgatgagggattcagagaatcaaattatcttctacgctcat
ggaaactcgttcgatcgcacattctaccatcgtgtggaaatgtacaatttgctcagtgat
tgtaattatcatgtcgtctgtttcgattatcgaggatatggagattcagaaggaacacca
accgaaaaaggaattgttgaagatacaaaaacagtatacgaatggctgaaggagaattgc
gggaagacgcctgttattgtatggggtcattcgatgggaactggtgtctcctgcaagttg
gtgcaagatctttcaagagaacagcaaccaccgtgcggtttaatcctcgaatcgccattc
aacaatttgaaggatgccgtaacaaatcatccgatcttcacagtgtttagctggatgaat
gacttcatggtagatcacatcatcattcgaccgctcaacagtgtcggcctcactatgcgt
tctgacaaacgcatcagattagtatcgtgtccaataatcatcctccacgccgaggacgac
aaaattcttcctgtgaagctgggaagagcgttgtacgaagcggcaaaagatgccgagagg
gatatcaaaattcgagagttttcatcagattatggtcttggtcataaattcatttgtcga
tatcctgagcttcccgaaattatcgaagaattcgtcgggagtgtcactccgccatccacg
ttaatcgcatcatcataa

DBGET integrated database retrieval system