KEGG   Caenorhabditis elegans (nematode): CELE_ZK131.9Help
Entry
CELE_ZK131.9      CDS       T00019                                 

Gene name
his-15
Definition
Protein HIS-15
Orthology
K11252  
histone H2B
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_ZK131.9 (his-15)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:13818371..13818739
Genome map
AA seq 122 aa AA seqDB search
MPPKPSAKGAKKAAKTVTKPKDGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIMN
SFVNDVFERIAAEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTS
SK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaagccatctgccaagggagccaagaaggccgccaagaccgttacgaagcca
aaggacggaaagaagagacgtcatgcccgtaaggaatcatactccgtctacatctaccgt
gtcctcaagcaagttcatccagacactggagtttcctccaaagccatgtctatcatgaac
tcttttgtcaacgatgtcttcgagcgtattgctgctgaagcatcccgtcttgctcactac
aacaagcgttccacaatctcatcccgcgaaattcagaccgctgtccgtctgatccttcca
ggagagcttgccaagcacgccgtgtctgagggaaccaaggccgttaccaagtacacttcc
agcaagtaa

DBGET integrated database retrieval system