KEGG   Caenorhabditis elegans (nematode): CELE_ZK328.1Help
Entry
CELE_ZK328.1      CDS       T00019                                 

Gene name
cyk-3
Definition
Protein CYK-3, isoform B
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.1.2.15]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CELE_ZK328.1 (cyk-3)
Peptidases [BR:cel01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CELE_ZK328.1 (cyk-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(6020163..6020235,6020283..6020353,6020394..6020547,6020596..6020712,6020762..6020998,6021045..6021309,6021356..6021518,6021565..6022168,6022284..6022534,6022582..6022984,6023029..6023912,6023960..6024109,6024159..6024251,6024299..6024370)
Genome map
AA seq 1178 aa AA seqDB search
MGNTLTGRSNAIAPIISAEDAKTYISDEEYRRIRQAFQRFKNGCINYDEFCYHVLGGAQI
PEEKRRLLFSFFSHGAETISFDNLLSSLVGLCRVEEVQSRFIEEYHEFASWGLSPPKLTI
PLNDSYISFYEVMSYVTHLSVNEVIELEKVFATISDRAVCKLNEEKWKQALGGCFPDSYA
ERLFAVFDENRDGQIDFRELVCTLSALCRGPLPGRISQLARIWDVDCDKLLSDEELSNMY
KDLNVPEEHQTVTKSSNGKSALVDFGIWAQENEKYVNEYYSMALQIGHICLGLRPESRKM
ELQIVNEFEKRASELPLSEWNIVASGWHAELRSFLEADKNPNPIDNSGIKGTREDSWTSK
VACISAESARLKPDLIPSDYIRVPVPLWRAWLRWHGCALTVDSQFTRKYLDGEFFEDNKP
ALELYPLEILLLGHDRKKSQDGTENTPRSLTSWACAQVSRSMTVDELLALCKTELRLGDG
DARLWQVVKENEEGNVLLDDGAQNLHQLYSSLGKTKKVNKMKLLLEVRERGTGVWPEELR
ASLSGKQITAASTLSSNAQLSDSSGRPGAVGLVNYGNFCYRNAGIQCLARVSPLTQYFLD
EDNLDAIKRGNLRRGDAAETTIEYAKLLREMWAAKKKNIAPNDFNDAIRLSSDMFECSEQ
HDCQEFVAFLLDQLHTSMYESNKSLHPSPEESEGTDSNKLSDSSKKKEADKEEADEEKAE
RSWTEYEKQNESLVTQLFTGQLRSRLICRTCQSSSSVFEPFTSLSLPIGFEDVDLYQVIV
VHRDGRIPRRYGFRLSRDSKVGNLREVVAVSSGISMSHLTIQCMSSKGTLMSRSPNHRSS
NLRDELPLSSFPSGARLYALELPESTGEDQWRVAMHRKLQYNHEPYILGSTAGFIVSRFG
LPLIVGLDEEVTGKKLYEDVMYQMHRFMEHSVNSSSSRAHDPCEDENSGYPFTLCLVDPN
YEWCGQCPALRFCRGCPIRPDESKVFIPANCPIAVDWLPIALYLRYNHSQEQACEDDPSV
AETWSRHFAPSSLEHCIEKFSCPETLDAAIQCDRCEKKTMRDKVMTIWKLPKYLIIHLKR
FEFLREQGRMGKCKRTVNFPLKHFDPAPFVDKPDGNTYECIALANHYGQLSCGHFIAYAK
SNEDKWLLLNDCSVREVSEEEVDKQGAYLLFYERKDVK
NT seq 3537 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacacgttaactggacgttcgaacgctatcgcaccgattatcagtgcggaagat
gctaaaacttatatatcggacgaggagtatcgacgaattcgccaagctttccaacgcttc
aaaaatggatgcattaattatgacgaattctgctatcatgttctcggaggcgcgcagata
ccagaagaaaaacgacgcctgctgttcagcttcttctctcatggcgctgaaaccatttcc
tttgacaatttgctttcatctcttgttggattgtgtagagtagaagaagtacaatcgagg
tttatcgaagaatatcacgagttcgcgtcatggggattgagtcctcctaagcttacgatt
ccgctcaatgattcctatatctcattttacgaagtgatgtcttatgtgacgcatttatcc
gtgaacgaggttatcgagttagagaaagtgttcgccacgatcagtgatcgagctgtctgc
aaactgaatgaagagaagtggaaacaagcattgggtggatgcttcccggatagttatgct
gagagattattcgctgttttcgatgagaatcgagatggtcaaattgacttcagagagctc
gtttgtacactttcggctctttgtcgtggacctctaccagggagaatttctcagttggca
cgaatctgggacgtcgactgtgacaaacttctgtctgacgaagaactttctaacatgtac
aaagatcttaatgtcccagaagaacatcagactgtcacaaaatcatcgaatgggaaatct
gctctcgttgattttggaatatgggcacaggaaaacgaaaaatatgtcaatgaatattat
tctatggctcttcaaatcggacacatttgtctcggattgagaccagagtcacggaaaatg
gaattacaaattgtgaacgaatttgaaaaacgtgcctctgagcttccactttccgagtgg
aacattgtagcttcaggatggcatgctgagctcagatccttcctggaagcagataaaaat
ccgaatccaatcgataattctggtatcaagggaacaagagaagatagctggaccagcaag
gttgcttgcatttcagctgaatcagctcgtctgaaacccgatcttattccatctgactac
atccgagtgcctgttccactttggagagcatggctccgatggcacggatgtgcactgaca
gtagattcacaattcacaagaaagtatctggatggtgaattctttgaagacaacaagccc
gctcttgaactgtatccactcgaaattctccttctgggccatgatcgtaagaagagccag
gatggtacagaaaacactccaagatccttgacatcctgggcgtgtgctcaagtatcacga
agtatgactgtggatgagcttctcgcgctgtgcaagacagaacttcgactcggagatgga
gacgcaaggctttggcaagttgtgaaggagaatgaagaaggaaatgtacttttggacgat
ggagcacaaaatctacatcaattatactcgtcactagggaaaacgaaaaaagtgaataaa
atgaagcttttactggaagtacgagaaagaggaacaggagtgtggccagaagaattacga
gcatctctttccgggaaacaaatcactgctgcttctactttatcctcgaatgcacaattg
tcagattcttcaggtcgcccaggagcagttggtcttgttaactacggtaacttctgttac
cgtaacgccggaatccagtgtcttgcgagagtttccccactcactcaatattttttggat
gaggataatttggatgctatcaaaagagggaacttgaggcgaggagatgcggcagagacg
acaattgagtatgcgaaactgctcagagaaatgtgggcagcgaagaagaaaaatattgct
ccgaatgattttaatgatgctattcgattgagctcggatatgtttgaatgtagtgagcag
catgattgtcaagaatttgtagcattcttgctggatcagcttcacacttcaatgtatgaa
tctaacaaaagtcttcatccatctcccgaagaatctgaaggaaccgattcaaataaattg
tcggattcaagcaaaaagaaagaagctgataaagaagaagctgatgaagaaaaagctgaa
agatcatggacggagtacgaaaaacaaaatgagtcactcgttacacagctcttcactggc
caactccgttcccgcctaatttgccgaacttgtcaatcgagctcgagtgtcttcgagcca
ttcacatcgttgtcgttgccaattggatttgaagatgttgatttgtatcaagttattgtt
gtacatagagacgggcgaatcccgcgtcgctatggtttccgattgtcacgtgactcgaag
gttggaaatctccgggaagtggttgccgtatcaagtggaatctcgatgtcacatctaacg
attcagtgtatgtccagtaaaggaacgcttatgagccgatccccaaatcatcgaagttca
aacttacgcgatgagctgccgctgagttcattcccttctggagcaagactttacgcttta
gagctaccagaaagtacaggtgaagatcagtggcgagttgcgatgcataggaagcttcag
tataaccatgaaccttacattcttggttcaactgccggattcatagtatctcgttttgga
cttcctttgatcgttggattggacgaagaagtaactggaaagaaattatacgaagatgta
atgtatcaaatgcatcgatttatggaacactctgtgaattcctcctcgagtagagctcat
gatccatgtgaagatgagaattcaggatatccattcactttatgtttggttgatccgaat
tatgaatggtgtgggcaatgcccggctctccgattctgcagaggatgtccaatccgtcca
gatgagagcaaagtattcattcctgccaactgtccgattgcagtggattggcttccaatc
gctctctaccttcgatacaatcactcgcaggagcaagcatgtgaagatgatccttcagtt
gccgaaacttggtcaaggcactttgctccaagctcattggagcactgcattgagaagttc
tcatgccctgagacacttgacgcagcaattcaatgtgaccgttgtgagaagaagacgatg
agagacaaagtgatgactatttggaagcttccgaagtacttgataattcatctcaaacgg
ttcgaatttctccgcgaacaaggtcgaatgggaaagtgcaaaagaacggtgaatttcccg
ttgaagcacttcgatccagctccatttgttgacaagcccgacggaaatacatatgaatgc
atcgcactcgctaatcactatggacaactatcctgtggacatttcatagcctatgcaaag
agcaatgaggacaaatggcttctgttgaatgactgttcggttcgagaagtatctgaagaa
gaagttgacaaacaaggcgcatatcttctgttctacgagagaaaagatgtcaaataa

DBGET integrated database retrieval system