KEGG   Caenorhabditis elegans (nematode): CELE_ZK328.1Help
Entry
CELE_ZK328.1      CDS       T00019                                 

Gene name
cyk-3
Definition
Protein CYK-3, isoform B
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.1.2.15]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CELE_ZK328.1 (cyk-3)
Peptidases [BR:cel01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CELE_ZK328.1 (cyk-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(6020212..6020284,6020332..6020402,6020443..6020596,6020645..6020761,6020811..6021047,6021094..6021358,6021405..6021567,6021614..6022217,6022333..6022583,6022631..6023033,6023078..6023961,6024009..6024158,6024208..6024300,6024348..6024419)
Genome map
AA seq 1178 aa AA seqDB search
MGNTLTGRSNAIAPIISAEDAKTYISDEEYRRIRQAFQRFKNGCINYDEFCYHVLGGAQI
PEEKRRLLFSFFSHGAETISFDNLLSSLVGLCRVEEVQSRFIEEYHEFASWGLSPPKLTI
PLNDSYISFYEVMSYVTHLSVNEVIELEKVFATISDRAVCKLNEEKWKQALGGCFPDSYA
ERLFAVFDENRDGQIDFRELVCTLSALCRGPLPGRISQLARIWDVDCDKLLSDEELSNMY
KDLNVPEEHQTVTKSSNGKSALVDFGIWAQENEKYVNEYYSMALQIGHICLGLRPESRKM
ELQIVNEFEKRASELPLSEWNIVASGWHAELRSFLEADKNPNPIDNSGIKGTREDSWTSK
VACISAESARLKPDLIPSDYIRVPVPLWRAWLRWHGCALTVDSQFTRKYLDGEFFEDNKP
ALELYPLEILLLGHDRKKSQDGTENTPRSLTSWACAQVSRSMTVDELLALCKTELRLGDG
DARLWQVVKENEEGNVLLDDGAQNLHQLYSSLGKTKKVNKMKLLLEVRERGTGVWPEELR
ASLSGKQITAASTLSSNAQLSDSSGRPGAVGLVNYGNFCYRNAGIQCLARVSPLTQYFLD
EDNLDAIKRGNLRRGDAAETTIEYAKLLREMWAAKKKNIAPNDFNDAIRLSSDMFECSEQ
HDCQEFVAFLLDQLHTSMYESNKSLHPSPEESEGTDSNKLSDSSKKKEADKEEADEEKAE
RSWTEYEKQNESLVTQLFTGQLRSRLICRTCQSSSSVFEPFTSLSLPIGFEDVDLYQVIV
VHRDGRIPRRYGFRLSRDSKVGNLREVVAVSSGISMSHLTIQCMSSKGTLMSRSPNHRSS
NLRDELPLSSFPSGARLYALELPESTGEDQWRVAMHRKLQYNHEPYILGSTAGFIVSRFG
LPLIVGLDEEVTGKKLYEDVMYQMHRFMEHSVNSSSSRAHDPCEDENSGYPFTLCLVDPN
YEWCGQCPALRFCRGCPIRPDESKVFIPANCPIAVDWLPIALYLRYNHSQEQACEDDPSV
AETWSRHFAPSSLEHCIEKFSCPETLDAAIQCDRCEKKTMRDKVMTIWKLPKYLIIHLKR
FEFLREQGRMGKCKRTVNFPLKHFDPAPFVDKPDGNTYECIALANHYGQLSCGHFIAYAK
SNEDKWLLLNDCSVREVSEEEVDKQGAYLLFYERKDVK
NT seq 3537 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacacgttaactggacgttcgaacgctatcgcaccgattatcagtgcggaagat
gctaaaacttatatatcggacgaggagtatcgacgaattcgccaagctttccaacgcttc
aaaaatggatgcattaattatgacgaattctgctatcatgttctcggaggcgcgcagata
ccagaagaaaaacgacgcctgctgttcagcttcttctctcatggcgctgaaaccatttcc
tttgacaatttgctttcatctcttgttggattgtgtagagtagaagaagtacaatcgagg
tttatcgaagaatatcacgagttcgcgtcatggggattgagtcctcctaagcttacgatt
ccgctcaatgattcctatatctcattttacgaagtgatgtcttatgtgacgcatttatcc
gtgaacgaggttatcgagttagagaaagtgttcgccacgatcagtgatcgagctgtctgc
aaactgaatgaagagaagtggaaacaagcattgggtggatgcttcccggatagttatgct
gagagattattcgctgttttcgatgagaatcgagatggtcaaattgacttcagagagctc
gtttgtacactttcggctctttgtcgtggacctctaccagggagaatttctcagttggca
cgaatctgggacgtcgactgtgacaaacttctgtctgacgaagaactttctaacatgtac
aaagatcttaatgtcccagaagaacatcagactgtcacaaaatcatcgaatgggaaatct
gctctcgttgattttggaatatgggcacaggaaaacgaaaaatatgtcaatgaatattat
tctatggctcttcaaatcggacacatttgtctcggattgagaccagagtcacggaaaatg
gaattacaaattgtgaacgaatttgaaaaacgtgcctctgagcttccactttccgagtgg
aacattgtagcttcaggatggcatgctgagctcagatccttcctggaagcagataaaaat
ccgaatccaatcgataattctggtatcaagggaacaagagaagatagctggaccagcaag
gttgcttgcatttcagctgaatcagctcgtctgaaacccgatcttattccatctgactac
atccgagtgcctgttccactttggagagcatggctccgatggcacggatgtgcactgaca
gtagattcacaattcacaagaaagtatctggatggtgaattctttgaagacaacaagccc
gctcttgaactgtatccactcgaaattctccttctgggccatgatcgtaagaagagccag
gatggtacagaaaacactccaagatccttgacatcctgggcgtgtgctcaagtatcacga
agtatgactgtggatgagcttctcgcgctgtgcaagacagaacttcgactcggagatgga
gacgcaaggctttggcaagttgtgaaggagaatgaagaaggaaatgtacttttggacgat
ggagcacaaaatctacatcaattatactcgtcactagggaaaacgaaaaaagtgaataaa
atgaagcttttactggaagtacgagaaagaggaacaggagtgtggccagaagaattacga
gcatctctttccgggaaacaaatcactgctgcttctactttatcctcgaatgcacaattg
tcagattcttcaggtcgcccaggagcagttggtcttgttaactacggtaacttctgttac
cgtaacgccggaatccagtgtcttgcgagagtttccccactcactcaatattttttggat
gaggataatttggatgctatcaaaagagggaacttgaggcgaggagatgcggcagagacg
acaattgagtatgcgaaactgctcagagaaatgtgggcagcgaagaagaaaaatattgct
ccgaatgattttaatgatgctattcgattgagctcggatatgtttgaatgtagtgagcag
catgattgtcaagaatttgtagcattcttgctggatcagcttcacacttcaatgtatgaa
tctaacaaaagtcttcatccatctcccgaagaatctgaaggaaccgattcaaataaattg
tcggattcaagcaaaaagaaagaagctgataaagaagaagctgatgaagaaaaagctgaa
agatcatggacggagtacgaaaaacaaaatgagtcactcgttacacagctcttcactggc
caactccgttcccgcctaatttgccgaacttgtcaatcgagctcgagtgtcttcgagcca
ttcacatcgttgtcgttgccaattggatttgaagatgttgatttgtatcaagttattgtt
gtacatagagacgggcgaatcccgcgtcgctatggtttccgattgtcacgtgactcgaag
gttggaaatctccgggaagtggttgccgtatcaagtggaatctcgatgtcacatctaacg
attcagtgtatgtccagtaaaggaacgcttatgagccgatccccaaatcatcgaagttca
aacttacgcgatgagctgccgctgagttcattcccttctggagcaagactttacgcttta
gagctaccagaaagtacaggtgaagatcagtggcgagttgcgatgcataggaagcttcag
tataaccatgaaccttacattcttggttcaactgccggattcatagtatctcgttttgga
cttcctttgatcgttggattggacgaagaagtaactggaaagaaattatacgaagatgta
atgtatcaaatgcatcgatttatggaacactctgtgaattcctcctcgagtagagctcat
gatccatgtgaagatgagaattcaggatatccattcactttatgtttggttgatccgaat
tatgaatggtgtgggcaatgcccggctctccgattctgcagaggatgtccaatccgtcca
gatgagagcaaagtattcattcctgccaactgtccgattgcagtggattggcttccaatc
gctctctaccttcgatacaatcactcgcaggagcaagcatgtgaagatgatccttcagtt
gccgaaacttggtcaaggcactttgctccaagctcattggagcactgcattgagaagttc
tcatgccctgagacacttgacgcagcaattcaatgtgaccgttgtgagaagaagacgatg
agagacaaagtgatgactatttggaagcttccgaagtacttgataattcatctcaaacgg
ttcgaatttctccgcgaacaaggtcgaatgggaaagtgcaaaagaacggtgaatttcccg
ttgaagcacttcgatccagctccatttgttgacaagcccgacggaaatacatatgaatgc
atcgcactcgctaatcactatggacaactatcctgtggacatttcatagcctatgcaaag
agcaatgaggacaaatggcttctgttgaatgactgttcggttcgagaagtatctgaagaa
gaagttgacaaacaaggcgcatatcttctgttctacgagagaaaagatgtcaaataa

DBGET integrated database retrieval system