KEGG   Caenorhabditis elegans (nematode): CELE_ZK370.4Help
Entry
CELE_ZK370.4      CDS       T00019                                 

Gene name
ZK370.4
Definition
Protein ZK370.4, isoform A
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cel00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:complement(join(8725512..8725672,8725726..8726014,8726061..8727348,8727470..8727753,8727803..8728157,8728230..8728402,8728672..8728773,8728830..8728924,8729518..8729617,8729666..8729962,8730014..8730161,8730207..8730365,8730412..8730563,8730615..8730841,8730896..8731031,8731230..8731292))
Genome map
AA seq 1342 aa AA seqDB search
MSFFYSLFAPLIFLVTFIYNHVLLILFTVCIIGAAAFFVSYYLFGYSNTPSSASSSATPS
SRNSPNKERSKKVPTILETDNEDDEIRVNGSPKSGTPTNTQTIEPPTSLNLNMVNSASGS
NLSGARRMRKRDWAKKLYKSLVQDSPGRTPTDESSDEENANVVMGGGSVPRRRSKHGNSS
RRRQSTAFQLAKDLIRRGSRSYFRQNQENNKDTRVRPPQEFFEPTDLPEIPQNLQPEIFY
ILHNLKMLELPSEWKLDPREIEVRSFQAGDYIVKPGESDDAIYVAIDGELTVHIRHMEGK
EYLVKCIPAGGSFFSLLSMLDILMDFPSIFRTVALKAADPCRVAKFPITSFRESYHKNPE
AWIRPIQIVITRLLHVTLTTLHQYMGLSSELMRRRRDDDRHRNGSSTSKLQLSLSLKKKE
KPFNINDNEQDQLIVARKWMAEAFGLVADDVVSEQIGSKIHLESYEAGHVIIEQGAEEEV
LMMVLHGNLILAQESLFDEENNEEDESAVIRVTARELVGGLQILTNEPSFYTIRAAVQTR
VAIMKKKDFSAFLEAHPEIYLPVAHSVLRRLSPFLRGVDFALDWVLVDSGHACYRAGDMA
DSLFVVLSGRLRSVEKKTVVEEFGRGDVLGMMEVLTKKPRATTVLAVRFSQLARVPEGLL
NFIKMQYPQVGFRLVQLLGQYYSQTNRRAPFAAPTVIRTNELGATDPMSHIKNLHTIAVV
PASPDVPLVPFTCELYHALSSNLRVLRLSSQKVAACLDPSVLEKQADFRLMHWLNVQEDT
YPLVIYECDFTQTNWTRRCLRQADAILVVAIGGKTPEKQTLMRELMNMNQDGVRTNKELI
LLWPESTKTPSGTIEWLKNSYFSGHHHIRAPKRMLQWNRKFRKMSRAEVMTPTSVENEVI
EYYEKNVFWTPDRRSDFSRLARILTGNAIGLVLGGGGARGAAHVGVLRALREEGIPVDIV
GGTSIGSLIGGLYAETPDDVVVETRAASWFNGMSSLWRKLLDLTYAHSAMFTGAQFNFSI
KDLFEERLIEDLWISYFCISTDISTSEMRVHRSGPLWAYCRASMSLAGYLPPLCDPQDGH
LLLDGGYVNNVPADVMRNLGARCVIACDVGSIEETNLYDYGDSLSGMWVLLKRLNPFGTP
PRILNMEEIQSRLAYVSCVRQLEVVKKASYCRYLRPPIEPFKTLDFPKFQEIMELGLKYG
REACHELITNDRAGILGDEKETRKFKRQQSRREKPDVSRAVSFTDLAAAMSKIPVVRPTL
RHSMSLNPSANGPVGRAGDHFLLDDDLFNDTDYYEEESSQSENGNESFTEDEDLVIGPPS
SSSSGGNVSENPRGTTPRPPSS
NT seq 4029 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcttctattccttatttgcacctctcatttttcttgtcacattcatttataat
catgttctccttattctattcactgtttgcataattggagccgccgcattcttcgtctcc
tactatctttttggttattcaaatactccatcatcagccagctccagtgccactccatca
tccagaaattctccaaacaaagaacgcagcaaaaaagttccgacaattttggagacggac
aacgaagatgatgaaatacgtgtcaatggatcacctaaatcaggaactccgactaatacg
caaacgattgaaccaccgacttcactcaatctcaatatggtcaattcagcaagtggatcg
aatctttcaggtgcaaggcgtatgagaaagagagattgggccaaaaaactatacaaaagt
cttgtgcaagactctcctggtcgcactccaacagatgaatcatcagacgaagaaaatgcg
aatgttgtgatgggtggaggatcagttccacgtaggcgtagcaagcatggaaactccagt
cggcgtcgacaatcaactgcattccaattggctaaagatttgatccgtcgtggaagtcga
tcttatttccggcagaatcaagagaataacaaggatactcgtgttcgtccaccacaagag
ttcttcgaaccaactgatctaccagaaattccacaaaacttgcagccagagattttctat
atccttcataatctcaaaatgctcgaactgccatccgagtggaagcttgatcctcgagag
attgaagttcgatccttccaagctggtgattatattgtaaagcctggagaatcagatgat
gcgatatatgttgcaatagatggagaattgacagttcatattcgtcacatggaaggcaaa
gaatatcttgtcaaatgtattccagctggtggcagcttcttttcattactttcaatgctt
gatattctcatggatttcccatcaatctttcgaactgttgcattgaaagcagctgatcca
tgtagagtcgcaaagtttccaattacatctttccgagagtcttatcataaaaatccagaa
gcatggatcagaccgatccaaattgtgatcactcgtcttcttcacgtcacattgacgaca
cttcatcagtatatgggattgagcagtgagttgatgagaagacgacgagacgacgatagg
catcgaaatggaagcagtacatccaaacttcaactctctttgtcgctgaaaaagaaagag
aaaccattcaatattaacgacaatgagcaagatcagctgattgtggccagaaaatggatg
gcagaagcgtttggtcttgttgcagatgatgttgtttctgaacaaatcggtagcaagatt
catttggaaagctacgaagctggtcatgtaatcattgaacaaggagccgaagaagaagtt
ttgatgatggttcttcatggaaatctcattcttgcacaggaatcattgtttgacgaggaa
aacaatgaagaagatgaaagtgcagtgatccgagtgactgctcgagaacttgttggaggt
cttcagattcttacaaatgagccatcgttttacacaattcgggccgcagtccagacaaga
gttgcaattatgaaaaagaaagacttttctgcattcctcgaagctcatccagagatctac
ctaccagttgctcactcggttctccgccgtctctcaccattccttcgtggagtcgacttt
gccctggactgggttcttgttgattcaggacatgcatgttatcgtgctggagatatggca
gactctttattcgttgttctcagtggacgtcttcgttcagttgagaaaaagactgtagtc
gaagaatttggccgtggagatgttcttggaatgatggaagtgctcacaaagaaacctcgt
gcaactacagtactcgctgtccgtttctcacaactcgctagggtaccagagggtcttttg
aattttatcaaaatgcaatatccacaggttggattccgtctcgtgcaacttctcggtcaa
tactacagtcagactaatcgtcgtgctccattcgctgctccaactgtgataagaacgaat
gagttgggagcgactgatccgatgagtcatatcaagaatcttcatactatcgcagttgtt
cctgcctcacctgatgtgcctcttgttccgttcacttgcgaactgtatcacgcactttca
tcaaaccttcgtgtacttcgcctcagtagtcaaaaagtagcagcatgcttggatccaagt
gttctcgagaaacaagccgacttccgattgatgcattggttgaatgttcaagaagacacg
tatccactggtgatctacgagtgtgactttactcaaactaactggacgagacgttgtttg
cgacaggctgatgccattcttgttgtggcgatcggtggaaagacacccgagaagcaaaca
cttatgagagagctgatgaacatgaatcaggatggtgttcgtacaaacaaagaattgatc
cttttgtggccagaaagtacaaagacaccgtctggaacaattgaatggcttaagaacagc
tacttctctggtcatcatcatatccgtgcaccaaagcgaatgcttcagtggaatcggaag
ttcagaaagatgagccgagctgaagtgatgacacctacaagtgtggaaaatgaagttatt
gagtactatgaaaagaatgtgttctggacaccggatcgaagatctgatttttcgagactt
gcgagaatcttgactggaaatgcaatcggactagtactgggtggaggtggagctagagga
gctgctcatgttggtgtattgagagctcttcgtgaagaaggaattccagttgatattgtt
ggaggaacttcgatcggatcactcattggtgggctatatgctgaaactccagatgatgta
gttgtcgagactcgagctgcttcctggttcaatggaatgtcttcattgtggagaaagctt
ctcgatctgacatatgctcatagtgcaatgttcactggtgctcaattcaatttttcaatc
aaagatctcttcgaagaacgacttattgaagatctctggatttcatacttttgcatctca
actgacattagcacttctgaaatgagagttcatcgatctggaccactttgggcatactgt
agagcctcaatgtcacttgctggatacttgccaccattgtgtgatccacaagatggacat
ttgcttcttgatggaggatacgttaacaatgttcctgctgatgttatgagaaatcttgga
gcacgatgtgtgattgcatgtgatgttggatcaattgaagagactaatttgtatgattac
ggtgactcgttaagcggaatgtgggttcttctgaaaagactcaatccattcggaactcct
cctcgtattctgaatatggaagaaattcaaagtcgtctcgcatatgtttcatgtgttcgt
cagttggaagttgtgaagaaggcatcgtactgtcgctacttgagaccaccgattgaaccc
ttcaagacgctcgattttccaaagttccaggaaattatggaactcggcttgaaatatgga
cgtgaagcatgtcatgaactgattacaaacgatcgtgctggaattctgggtgacgagaaa
gagacaagaaagttcaagagacaacagagccgtcgtgagaagcccgatgtttcccgagcg
gtttcattcactgatcttgccgcagcgatgtcaaagatcccggttgttcgacccactctt
cgtcattctatgagcttgaatccatcagctaatggaccagttggaagagccggcgatcat
ttcctattagatgatgatttgtttaatgataccgattattacgaggaggaatcatcgcag
tctgaaaatggaaacgagtcgttcacagaagatgaagatcttgtcatcggtccaccgagc
agctcatcgtctggtggaaatgttagtgaaaatccacgtggcacaactccacgacctcct
tcttcctga

DBGET integrated database retrieval system