KEGG   Caenorhabditis elegans (nematode): CELE_ZK370.4Help
Entry
CELE_ZK370.4      CDS       T00019                                 

Gene name
ZK370.4
Definition
Protein ZK370.4, isoform A
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CELE_ZK370.4 (ZK370.4)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CELE_ZK370.4 (ZK370.4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:complement(join(8725593..8725753,8725807..8726095,8726142..8727429,8727551..8727834,8727884..8728238,8728311..8728483,8728753..8728854,8728911..8729005,8729599..8729698,8729747..8730043,8730095..8730242,8730288..8730446,8730493..8730644,8730696..8730922,8730977..8731112,8731311..8731373))
Genome map
AA seq 1342 aa AA seqDB search
MSFFYSLFAPLIFLVTFIYNHVLLILFTVCIIGAAAFFVSYYLFGYSNTPSSASSSATPS
SRNSPNKERSKKVPTILETDNEDDEIRVNGSPKSGTPTNTQTIEPPTSLNLNMVNSASGS
NLSGARRMRKRDWAKKLYKSLVQDSPGRTPTDESSDEENANVVMGGGSVPRRRSKHGNSS
RRRQSTAFQLAKDLIRRGSRSYFRQNQENNKDTRVRPPQEFFEPTDLPEIPQNLQPEIFY
ILHNLKMLELPSEWKLDPREIEVRSFQAGDYIVKPGESDDAIYVAIDGELTVHIRHMEGK
EYLVKCIPAGGSFFSLLSMLDILMDFPSIFRTVALKAADPCRVAKFPITSFRESYHKNPE
AWIRPIQIVITRLLHVTLTTLHQYMGLSSELMRRRRDDDRHRNGSSTSKLQLSLSLKKKE
KPFNINDNEQDQLIVARKWMAEAFGLVADDVVSEQIGSKIHLESYEAGHVIIEQGAEEEV
LMMVLHGNLILAQESLFDEENNEEDESAVIRVTARELVGGLQILTNEPSFYTIRAAVQTR
VAIMKKKDFSAFLEAHPEIYLPVAHSVLRRLSPFLRGVDFALDWVLVDSGHACYRAGDMA
DSLFVVLSGRLRSVEKKTVVEEFGRGDVLGMMEVLTKKPRATTVLAVRFSQLARVPEGLL
NFIKMQYPQVGFRLVQLLGQYYSQTNRRAPFAAPTVIRTNELGATDPMSHIKNLHTIAVV
PASPDVPLVPFTCELYHALSSNLRVLRLSSQKVAACLDPSVLEKQADFRLMHWLNVQEDT
YPLVIYECDFTQTNWTRRCLRQADAILVVAIGGKTPEKQTLMRELMNMNQDGVRTNKELI
LLWPESTKTPSGTIEWLKNSYFSGHHHIRAPKRMLQWNRKFRKMSRAEVMTPTSVENEVI
EYYEKNVFWTPDRRSDFSRLARILTGNAIGLVLGGGGARGAAHVGVLRALREEGIPVDIV
GGTSIGSLIGGLYAETPDDVVVETRAASWFNGMSSLWRKLLDLTYAHSAMFTGAQFNFSI
KDLFEERLIEDLWISYFCISTDISTSEMRVHRSGPLWAYCRASMSLAGYLPPLCDPQDGH
LLLDGGYVNNVPADVMRNLGARCVIACDVGSIEETNLYDYGDSLSGMWVLLKRLNPFGTP
PRILNMEEIQSRLAYVSCVRQLEVVKKASYCRYLRPPIEPFKTLDFPKFQEIMELGLKYG
REACHELITNDRAGILGDEKETRKFKRQQSRREKPDVSRAVSFTDLAAAMSKIPVVRPTL
RHSMSLNPSANGPVGRAGDHFLLDDDLFNDTDYYEEESSQSENGNESFTEDEDLVIGPPS
SSSSGGNVSENPRGTTPRPPSS
NT seq 4029 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcttctattccttatttgcacctctcatttttcttgtcacattcatttataat
catgttctccttattctattcactgtttgcataattggagccgccgcattcttcgtctcc
tactatctttttggttattcaaatactccatcatcagccagctccagtgccactccatca
tccagaaattctccaaacaaagaacgcagcaaaaaagttccgacaattttggagacggac
aacgaagatgatgaaatacgtgtcaatggatcacctaaatcaggaactccgactaatacg
caaacgattgaaccaccgacttcactcaatctcaatatggtcaattcagcaagtggatcg
aatctttcaggtgcaaggcgtatgagaaagagagattgggccaaaaaactatacaaaagt
cttgtgcaagactctcctggtcgcactccaacagatgaatcatcagacgaagaaaatgcg
aatgttgtgatgggtggaggatcagttccacgtaggcgtagcaagcatggaaactccagt
cggcgtcgacaatcaactgcattccaattggctaaagatttgatccgtcgtggaagtcga
tcttatttccggcagaatcaagagaataacaaggatactcgtgttcgtccaccacaagag
ttcttcgaaccaactgatctaccagaaattccacaaaacttgcagccagagattttctat
atccttcataatctcaaaatgctcgaactgccatccgagtggaagcttgatcctcgagag
attgaagttcgatccttccaagctggtgattatattgtaaagcctggagaatcagatgat
gcgatatatgttgcaatagatggagaattgacagttcatattcgtcacatggaaggcaaa
gaatatcttgtcaaatgtattccagctggtggcagcttcttttcattactttcaatgctt
gatattctcatggatttcccatcaatctttcgaactgttgcattgaaagcagctgatcca
tgtagagtcgcaaagtttccaattacatctttccgagagtcttatcataaaaatccagaa
gcatggatcagaccgatccaaattgtgatcactcgtcttcttcacgtcacattgacgaca
cttcatcagtatatgggattgagcagtgagttgatgagaagacgacgagacgacgatagg
catcgaaatggaagcagtacatccaaacttcaactctctttgtcgctgaaaaagaaagag
aaaccattcaatattaacgacaatgagcaagatcagctgattgtggccagaaaatggatg
gcagaagcgtttggtcttgttgcagatgatgttgtttctgaacaaatcggtagcaagatt
catttggaaagctacgaagctggtcatgtaatcattgaacaaggagccgaagaagaagtt
ttgatgatggttcttcatggaaatctcattcttgcacaggaatcattgtttgacgaggaa
aacaatgaagaagatgaaagtgcagtgatccgagtgactgctcgagaacttgttggaggt
cttcagattcttacaaatgagccatcgttttacacaattcgggccgcagtccagacaaga
gttgcaattatgaaaaagaaagacttttctgcattcctcgaagctcatccagagatctac
ctaccagttgctcactcggttctccgccgtctctcaccattccttcgtggagtcgacttt
gccctggactgggttcttgttgattcaggacatgcatgttatcgtgctggagatatggca
gactctttattcgttgttctcagtggacgtcttcgttcagttgagaaaaagactgtagtc
gaagaatttggccgtggagatgttcttggaatgatggaagtgctcacaaagaaacctcgt
gcaactacagtactcgctgtccgtttctcacaactcgctagggtaccagagggtcttttg
aattttatcaaaatgcaatatccacaggttggattccgtctcgtgcaacttctcggtcaa
tactacagtcagactaatcgtcgtgctccattcgctgctccaactgtgataagaacgaat
gagttgggagcgactgatccgatgagtcatatcaagaatcttcatactatcgcagttgtt
cctgcctcacctgatgtgcctcttgttccgttcacttgcgaactgtatcacgcactttca
tcaaaccttcgtgtacttcgcctcagtagtcaaaaagtagcagcatgcttggatccaagt
gttctcgagaaacaagccgacttccgattgatgcattggttgaatgttcaagaagacacg
tatccactggtgatctacgagtgtgactttactcaaactaactggacgagacgttgtttg
cgacaggctgatgccattcttgttgtggcgatcggtggaaagacacccgagaagcaaaca
cttatgagagagctgatgaacatgaatcaggatggtgttcgtacaaacaaagaattgatc
cttttgtggccagaaagtacaaagacaccgtctggaacaattgaatggcttaagaacagc
tacttctctggtcatcatcatatccgtgcaccaaagcgaatgcttcagtggaatcggaag
ttcagaaagatgagccgagctgaagtgatgacacctacaagtgtggaaaatgaagttatt
gagtactatgaaaagaatgtgttctggacaccggatcgaagatctgatttttcgagactt
gcgagaatcttgactggaaatgcaatcggactagtactgggtggaggtggagctagagga
gctgctcatgttggtgtattgagagctcttcgtgaagaaggaattccagttgatattgtt
ggaggaacttcgatcggatcactcattggtgggctatatgctgaaactccagatgatgta
gttgtcgagactcgagctgcttcctggttcaatggaatgtcttcattgtggagaaagctt
ctcgatctgacatatgctcatagtgcaatgttcactggtgctcaattcaatttttcaatc
aaagatctcttcgaagaacgacttattgaagatctctggatttcatacttttgcatctca
actgacattagcacttctgaaatgagagttcatcgatctggaccactttgggcatactgt
agagcctcaatgtcacttgctggatacttgccaccattgtgtgatccacaagatggacat
ttgcttcttgatggaggatacgttaacaatgttcctgctgatgttatgagaaatcttgga
gcacgatgtgtgattgcatgtgatgttggatcaattgaagagactaatttgtatgattac
ggtgactcgttaagcggaatgtgggttcttctgaaaagactcaatccattcggaactcct
cctcgtattctgaatatggaagaaattcaaagtcgtctcgcatatgtttcatgtgttcgt
cagttggaagttgtgaagaaggcatcgtactgtcgctacttgagaccaccgattgaaccc
ttcaagacgctcgattttccaaagttccaggaaattatggaactcggcttgaaatatgga
cgtgaagcatgtcatgaactgattacaaacgatcgtgctggaattctgggtgacgagaaa
gagacaagaaagttcaagagacaacagagccgtcgtgagaagcccgatgtttcccgagcg
gtttcattcactgatcttgccgcagcgatgtcaaagatcccggttgttcgacccactctt
cgtcattctatgagcttgaatccatcagctaatggaccagttggaagagccggcgatcat
ttcctattagatgatgatttgtttaatgataccgattattacgaggaggaatcatcgcag
tctgaaaatggaaacgagtcgttcacagaagatgaagatcttgtcatcggtccaccgagc
agctcatcgtctggtggaaatgttagtgaaaatccacgtggcacaactccacgacctcct
tcttcctga

DBGET integrated database retrieval system